LOCUS       BC021923                1891 bp    mRNA    linear   HUM 19-APR-2005
DEFINITION  Homo sapiens tetraspanin 10, mRNA (cDNA clone MGC:31784
            IMAGE:4876887), complete cds.
ACCESSION   BC021923
VERSION     BC021923.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1891)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1891)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-JAN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 40 Row: n Column: 22
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 31543356.
FEATURES             Location/Qualifiers
     source          1..1891
                     /db_xref="H-InvDB:HIT000258966"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:31784 IMAGE:4876887"
                     /tissue_type="Skin, melanotic melanoma, high MDR."
                     /clone_lib="NIH_MGC_49"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1891
                     /gene="TSPAN10"
                     /gene_synonym="OCSP"
                     /db_xref="GeneID:83882"
     CDS             78..785
                     /gene="TSPAN10"
                     /gene_synonym="OCSP"
                     /codon_start=1
                     /product="TSPAN10 protein"
                     /protein_id="AAH21923.1"
                     /db_xref="GeneID:83882"
                     /translation="MEEGERSPLLSQETAGQKPLSVHRPPTSGCLGPVPREDQAEAWG
                     CSCCPPETKHQALSGTPKKGPAPSLSPGSSCVKYLIFLSNFPFSLLGLLALAIGLWGL
                     AVKGSLGSDLGGPLPADPMLGLALGGLVVSAVSLAGYLGALCENTCLLRGFSGGILAF
                     LVLEAVAGALVVALWGPLQDSLEHTLRVAIAHYQDDPDLRFLLDQVQLGLRCCGAASY
                     QDWQQNLYCLSSPCSSQ"
BASE COUNT          315 a          682 c          568 g          326 t
ORIGIN      
        1 ccagcagccc agccacagag gagccagcga acctctcccg gcgcctgtgc tgggggcttt
       61 ctgttccagc gtcaaggatg gaggaggggg agaggagccc cttactgtcc caggaaactg
      121 caggccagaa gcccctctct gtgcacaggc cacccacctc aggctgccta ggtccagtgc
      181 ccagggagga ccaggcggag gcctggggct gcagctgctg tcccccggag accaagcacc
      241 aggccttgag tggcaccccc aagaaaggac cagccccttc cctctcccca gggagcagct
      301 gcgtcaagta tctgatcttc ctctccaact tccccttctc cctgctgggg ctgctggccc
      361 tggccatcgg gctctggggc ctggctgtca aggggtctct gggaagtgat ctgggggggc
      421 ccctgcccgc agaccccatg ctggggctgg cactgggagg gctggtggtc agcgcagtga
      481 gcctggctgg ctacctgggc gccctctgtg agaacacctg cctgttacgt ggcttctctg
      541 ggggcatcct tgccttcctg gtgcttgagg ccgtggcggg ggccctggtg gtggccctct
      601 ggggcccgct gcaagacagc ctggagcaca ccctgcgtgt ggccatcgcc cactaccagg
      661 acgacccaga cctgcgcttc ctcctcgacc aagtccagct cgggctgagg tgctgcggag
      721 ctgcctccta ccaggactgg cagcagaacc tgtactgcct ctcaagccct tgctcttccc
      781 agtaagacct gtggaccatt ccagaagcct ctgccagagt tccatccacc ctcccctgct
      841 ccaactctac cttctcaatg agctcagcag cctctgcgga gggaggtcct cttatcaatg
      901 cttgtctgtt cccccttcaa ccgtctcact aaatatcctc ctgctagtca acacagccac
      961 cacccctacc tgcaagcgca gaggactgcc gtgcacaggg atacgttata gagagccagg
     1021 tactttaact aactgcagct cccccggggt gcaggcctgc agccttcccg cctcctgctg
     1081 catcgacccc cgcgaagatg gagcctctgt caacgaccag tgcggcttcg gggtcctgcg
     1141 cctggatgcg gacgcagctc agagagtggt gtacctggag ggctgcggcc cgccgctccg
     1201 gcggtggctg cgcgcgaacc tggctgcctc gggcggctac gcaatcgcgg tggtgctgct
     1261 gcagggcgcg gagctcctgc tggccgcccg gctactcggg gccctcgctg cccgcagtgg
     1321 ggcggcgtac ggccccggag cgcgcgggga ggaccgcgct ggcccccaga gccccagccc
     1381 cggcgccccg cccgctgcca agcccgcccg gggctgagcg cacgccccga ggtccgagac
     1441 cgccacgcac agggatacag ggggcgcctc cgcccggcta aaaagcgcgg cctgcgccgc
     1501 cgccgccgcc tgatttcgct cgggcttcgg gtgacttcgc cgcaggacct acccagctcg
     1561 ctcacttcgc tcgctccgcg tcccccatgc cagcccccaa cgcagggcgc ccggcgaagc
     1621 cacgggactg gcgggaggag cacgcggggc cggaggaaat cctgaagctg accctcacct
     1681 ccgagccccc actcccaccc cagccgcaca gttcccacct cctggcacct ccctcccctg
     1741 gggccgccac cccttctggg ctcgtgatgg tggagctaag gtccaggcct ctccctcccg
     1801 agtgcatttt tggggagata gtaaatgttt tattcgggtg tatcattcat acagtaaaga
     1861 caccaatctt caaaaaaaaa aaaaaaaaaa a
//