LOCUS       BC021258                1384 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens tripartite motif-containing 5, mRNA (cDNA clone
            MGC:29623 IMAGE:4122548), complete cds.
ACCESSION   BC021258
VERSION     BC021258.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1384)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1384)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JAN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC021258.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 39 Row: c Column: 5
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 15011945.
FEATURES             Location/Qualifiers
     source          1..1384
                     /db_xref="H-InvDB:HIT000039175"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:29623 IMAGE:4122548"
                     /tissue_type="Muscle, rhabdomyosarcoma"
                     /clone_lib="NIH_MGC_17"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1384
                     /gene="TRIM5"
                     /gene_synonym="RNF88"
                     /gene_synonym="TRIM5alpha"
                     /db_xref="GeneID:85363"
                     /db_xref="HGNC:HGNC:16276"
                     /db_xref="MIM:608487"
     CDS             237..1280
                     /gene="TRIM5"
                     /gene_synonym="RNF88"
                     /gene_synonym="TRIM5alpha"
                     /codon_start=1
                     /product="tripartite motif-containing 5"
                     /protein_id="AAH21258.1"
                     /db_xref="GeneID:85363"
                     /db_xref="HGNC:HGNC:16276"
                     /db_xref="MIM:608487"
                     /translation="MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHK
                     KSMLDKGESSCPVCRISYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKL
                     LLFCQEDGKVICWLCERSQEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELE
                     ADIREEKASWKTQIQYDKTNVLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSE
                     TEMVQQTQSLRELISDLEHRLQGSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVF
                     RAPDLKGMLEVFRELTDVRRYWGKEKSHYHKPPCGLSLLLSLSFRILCSLLGSCFKIY
                     DSPSKTHITYPSL"
BASE COUNT          399 a          305 c          355 g          325 t
ORIGIN      
        1 ctttgtgcag atcaggcccg tggattggtg agtgaatcct aaccacgtct tccctggcct
       61 gtcttcactc ttctccccag aatcaccact tctgcactgg tgtctgaagg tgtattgagt
      121 gattttgtgg agggcagaag taggaagtct ttgggacaaa actgtattta ccttgggatc
      181 tgtgaacaag aggaacctca gcagccagga caggcaggag cagtggaata gctagtatgg
      241 cttctggaat cctggttaat gtaaaggagg aggtgacctg ccccatctgc ctggaactcc
      301 tgacacaacc cctgagcctg gactgcggcc acagcttctg ccaagcatgc ctcactgcaa
      361 accacaagaa gtccatgcta gacaaaggag agagtagctg ccctgtgtgc cggatcagtt
      421 accagcctga gaacatacgg cctaatcggc atgtagccaa catagtggag aagctcaggg
      481 aggtcaagtt gagcccagag gggcagaaag ttgatcattg tgcacgccat ggagagaaac
      541 ttctactctt ctgtcaggag gacgggaagg tcatttgctg gctttgtgag cggtctcagg
      601 agcaccgtgg tcaccacacg ttcctcacag aggaggttgc ccgggagtac caagtgaagc
      661 tccaggcagc tctggagatg ctgaggcaga agcagcagga agctgaagag ttggaagctg
      721 acatcagaga agagaaagct tcctggaaga ctcaaataca gtatgacaaa accaacgtct
      781 tggcagattt tgagcaactg agagacatcc tggactggga ggagagcaat gagctgcaaa
      841 acctggagaa ggaggaggaa gacattctga aaagccttac gaactctgaa actgagatgg
      901 tgcagcagac ccagtccctg agagagctca tctcagatct ggagcatcgg ctgcaggggt
      961 cagtgatgga gctgcttcag ggtgtggatg gcgtcataaa aaggacggag aacgtgacct
     1021 tgaagaagcc agaaactttt ccaaaaaatc aaaggagagt gtttcgagct cctgatctga
     1081 aaggaatgct agaagtgttt agagagctga cagatgtccg acgctactgg ggtaaggaga
     1141 agtcacatta tcataagcca ccctgcggct tatcattatt attatcttta tcttttagaa
     1201 ttttatgttc tctattaggc tcatgtttta agatttatga ttctccttcc aagacacaca
     1261 taacttaccc ctccttataa cttctaaaca aggttcctcc cagttttctc tcaagtcttt
     1321 atcaagattt ctctcatatc acaaataaag ttacattata tcccttaaaa aaaaaaaaaa
     1381 aaaa
//