LOCUS       BC020835                 875 bp    mRNA    linear   HUM 18-AUG-2005
DEFINITION  Homo sapiens transmembrane protein 68, mRNA (cDNA clone MGC:23925
            IMAGE:4806471), complete cds.
ACCESSION   BC020835
VERSION     BC020835.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 875)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 875)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JAN-2002) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 37 Row: o Column: 10
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 22748882.
FEATURES             Location/Qualifiers
     source          1..875
                     /db_xref="H-InvDB:HIT000038994"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:23925 IMAGE:4806471"
                     /tissue_type="Prostate, adenocarcinoma."
                     /clone_lib="NIH_MGC_60"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..875
                     /gene="TMEM68"
                     /gene_synonym="FLJ32370"
                     /db_xref="GeneID:137695"
     CDS             213..620
                     /gene="TMEM68"
                     /gene_synonym="FLJ32370"
                     /codon_start=1
                     /product="TMEM68 protein"
                     /protein_id="AAH20835.1"
                     /db_xref="GeneID:137695"
                     /translation="MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYL
                     LWVFTPLILLILPYFTIFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDG
                     HAAVWHGKQGYFHLCVAIHVCCIGTVLPFHFID"
BASE COUNT          282 a          155 c          166 g          272 t
ORIGIN      
        1 gcttctttca cacgggttgc ttcggaggaa tccgccgtgc aaatctgtcc gcccccttgg
       61 ccactgatcc cccgaagagc ttctgtcgcc gctctaggaa tacagacatt gaagtttggg
      121 acaagatatt tatctaactt ctgtgtcaaa attagcgacc tgctatggca atgaagaaag
      181 aaactgaatt tgtcattttc acctgaagaa aaatgataga caaaaatcaa acctgtggtg
      241 taggacagga ttctgtgccc tatatgattt gtctgattca catactcgaa gaatggtttg
      301 gtgtggagca gttggaggac tatttgaatt ttgcaaacta tctcttgtgg gtttttacac
      361 cactaatact tttaatactt ccttacttta ctatctttct tctctacctt actattattt
      421 tcttacacat ttataagaga aagaatgtat tgaaagaagc ctactctcat aatttatggg
      481 atggtgcaag gaaaacagtg gcaactctgt gggatggaca tgcagccgtt tggcatggta
      541 agcaaggata ctttcacctt tgtgttgcca ttcatgtgtg ctgcattgga actgtgttac
      601 cattccattt tattgattga gaagatactg aaaaatataa tagaagtgat atttactatt
      661 ccctgttacc tgtttgcatg cattgtgcat atgtatgtgt ctttcttaaa atgagttttc
      721 ccatagacgt tggtttccat taaacaaaga accacgcagc actgtagact ataagttgaa
      781 ataagaaaat ttatatttaa aacatctaaa agagtaagag actaaataaa gctgtagaaa
      841 actgccaaaa aaaaaaaaaa aaaaaaaaaa aaaaa
//