LOCUS       BC018765                2715 bp    mRNA    linear   HUM 04-JUN-2004
DEFINITION  Homo sapiens tripartite motif-containing 41, mRNA (cDNA clone
            IMAGE:3606188), partial cds.
ACCESSION   BC018765
VERSION     BC018765.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2715)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2715)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Steve Jones, Sarah Barber, Mabel Brown-John, Yaron Butterfield,
            Andy Chan, Steve S. Chand, William Chow, Alison Cloutier, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald, Amara Masson, Mike R. Mayo, Josh Moran, Ryan Morin,
            Teika Olson, Diana Palmquist, Anca Petrescu, Anna Liisa Prahbu,
            Parvaneh Saeedi, JR Santos, Angelique Schnerch, Ursula Skalska,
            Duane Smailus, Jeff Stott, Miranda Tsai, George Yang, Jacquie
            Schein, Asim Siddiqui, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 40 Row: a Column: 23
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 20127663.
FEATURES             Location/Qualifiers
     source          1..2715
                     /db_xref="H-InvDB:HIT000038447"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3606188"
                     /tissue_type="Uterus, endometrium adenocarcinoma"
                     /clone_lib="NIH_MGC_44"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            <1..2715
                     /gene="TRIM41"
                     /gene_synonym="MGC1127"
                     /gene_synonym="MGC31991"
                     /db_xref="GeneID:90933"
     CDS             <1..1661
                     /gene="TRIM41"
                     /gene_synonym="MGC1127"
                     /gene_synonym="MGC31991"
                     /codon_start=3
                     /product="TRIM41 protein"
                     /protein_id="AAH18765.2"
                     /db_xref="GeneID:90933"
                     /translation="GAGWDTPMRDEDYEGDMEEEVEEEEEGVFWTSGMSRSSWDNMDY
                     VWEEEDEEEDLDYYLGDMEEEDLRGEDEEDEEEVLEEVEEEDLDPVTPLPPPPAPRRC
                     FTCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPTPGRGSRVTDQGICPKHQEALKLFC
                     EVDEEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEE
                     RRVTELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAASRLA
                     EQAAQLSRLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEVWSPDPCQPHSHDF
                     LTDAIVRKMSRMFCQAARVDLTLDPDTAHPALMLSPDRRGVRLAERRQEVADHPKRFS
                     ADCCVLGAQGFRSGRHYWEVEVGGRRGWAVGAARESTHHKEKVGPGGSSVGSGDASSS
                     RHHHRRRRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYE
                     AGRLGFYNAETLAHVHTFSAAFLGERVFPFFRVLSKGTRIKLCP"
BASE COUNT          572 a          764 c          822 g          557 t
ORIGIN      
        1 ctggcgcggg gtgggacacc cccatgcggg atgaagacta cgagggtgac atggaggagg
       61 aggtcgagga ggaagaagag ggtgtgttct ggaccagtgg catgagcagg tccagctggg
      121 acaacatgga ctatgtgtgg gaggaggagg acgaggagga agacctggac tactacttgg
      181 gggacatgga ggaggaggac ctgagggggg aggatgagga ggacgaggag gaagtgctgg
      241 aggaggttga ggaagaggat ctagaccccg tcaccccact gcccccgcct ccagcccctc
      301 ggaggtgctt cacatgccct cagtgccgaa agagctttcc tcggcggagc ttccgcccca
      361 acctgcagct ggccaatatg gtccaggtga ttcggcagat gcacccaacc cctggtcgag
      421 ggagccgcgt gaccgatcag ggcatctgtc ccaaacacca agaagccctg aagctcttct
      481 gcgaggtaga cgaagaggcc atctgtgtgg tgtgccgaga atccaggagc cacaaacagc
      541 acagcgtggt gccattggag gaggtggtgc aggagtacaa ggccaaactg caggggcacg
      601 tggaaccact gaggaagcac ctggaggcag tgcagaagat gaaagccaag gaggagaggc
      661 gagtgacaga actgaagagc cagatgaagt cagagctggc agcggtggcc tcggagtttg
      721 ggcgactgac acggtttctg gctgaagagc aggcagggct ggaacggcgt ctcagagaga
      781 tgcatgaagc ccagctgggg cgtgcgggag ccgcggctag tcgccttgca gaacaggccg
      841 cccagctcag ccgcctgctg gcagaggccc aggagcggag ccagcagggg ggtctccggc
      901 tgctccagga catcaaggag actttcaata ggtgtgaaga ggtacagctg cagcccccag
      961 aggtctggtc ccctgacccg tgccaacccc atagccatga cttcctgaca gatgccatcg
     1021 tgaggaaaat gagccggatg ttctgtcagg ctgcgagagt ggacctgacg ctggaccctg
     1081 acacggctca cccggccctg atgctgtccc ctgaccgccg gggggtccgc ctggcagagc
     1141 ggcggcagga ggttgctgac catcccaagc gcttctcggc cgactgctgc gtactggggg
     1201 cccagggctt ccgctccggc cggcactact gggaggtaga ggtgggcggg cggcggggct
     1261 gggcggtggg tgctgcccgt gaatcaaccc atcataagga aaaggtgggc cctgggggtt
     1321 cctccgtggg cagcggggat gccagctcct cgcgccatca ccatcgccgc cgccggctcc
     1381 acctgcccca gcagcccctg ctccagcggg aagtgtggtg cgtgggcacc aacggcaaac
     1441 gctatcaggc ccagagctcc acagaacaga cgctgctgag ccccagtgag aaaccaaggc
     1501 gctttggtgt gtacctggac tatgaagctg ggcgcctggg cttctacaac gcagagactc
     1561 tagcccacgt gcacaccttc tcggctgcct tcctgggcga gcgtgtcttt cctttcttcc
     1621 gggtgctctc caagggcacc cgcatcaagc tctgcccttg attatcctgc cacccgcagg
     1681 ggcccctctg tcagcacttg gggggtgggt ggtggagggt ggcccgtaag tttgagggct
     1741 caaaggctct tcccactgct tgttactgtg ttgcttccca ctcccccttg accccaggcc
     1801 cctgcttctc cctctaggag cctaaagaac cctcctggcc tccagctcag ccttctctca
     1861 cctactatgt ctgtccaaca ggtctgcatg ggtccctgat aatgagaaca gctgcctggt
     1921 cttctctccc agtctgccta gcccagccct gggactggaa tttgagtagg ggatgagggg
     1981 aaattgtaat ttcattcctt aacttccttt tccccacccc tgctcttcaa cctctttatc
     2041 agttctgagg ctggagggtt tgggcaaggc aacatcccca ttccaattcc attttctgat
     2101 gcagatttta gctgagggat ttggaagcca tttggggagg caggctgggc caaagggtag
     2161 agctgggtaa taaatgtcta ttctcctggg gaggagggat tctaaacttt ccttccgtcc
     2221 tcaatttcta cctccataga ccggccagaa tttagcttca cttgagagag atctggaatg
     2281 gtcgccatga ttgaaaccac gcaccattac atcatcatta cattaattac atcaacataa
     2341 attatttctt cccccttccc ttttccagca ctcaaccaag gagcaaagct catcccaccc
     2401 cacacccctc ccagatctgc tcactgccag gctcctctcc cctttgttca gtggagctgg
     2461 cttttctccc agcccctttc catgcctttc actccatttg gcaagctctg agggggagcc
     2521 tggggacggg tttgggtccc caggaggaga gccttgggta taatctattt ttctaggagc
     2581 ctcttgcctt gtcacttgca gctttcgccc tctgctttga tggctgaggt gaactcatgt
     2641 tctttgggaa aagggaaggc gtgctgtgga aataaaatgt ttatttgctt ctctaaaaaa
     2701 aaaaaaaaaa aaaaa
//