LOCUS       BC018115                2426 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens TAF6 RNA polymerase II, TATA box binding protein
            (TBP)-associated factor, 80kDa, mRNA (cDNA clone MGC:8964
            IMAGE:3905205), complete cds.
ACCESSION   BC018115
VERSION     BC018115.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2426)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2426)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 22 Row: i Column: 10
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 21536360.
FEATURES             Location/Qualifiers
     source          1..2426
                     /db_xref="H-InvDB:HIT000038274"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:8964 IMAGE:3905205"
                     /tissue_type="Pancreas, epithelioid carcinoma"
                     /clone_lib="NIH_MGC_70"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2426
                     /gene="TAF6"
                     /gene_synonym="MGC:8964"
                     /gene_synonym="TAFII70"
                     /gene_synonym="TAFII80"
                     /gene_synonym="TAFII85"
                     /db_xref="GeneID:6878"
                     /db_xref="HGNC:HGNC:11540"
                     /db_xref="MIM:602955"
     CDS             198..2231
                     /gene="TAF6"
                     /gene_synonym="MGC:8964"
                     /gene_synonym="TAFII70"
                     /gene_synonym="TAFII80"
                     /gene_synonym="TAFII85"
                     /codon_start=1
                     /product="TAF6 RNA polymerase II, TATA box binding protein
                     (TBP)-associated factor, 80kDa"
                     /protein_id="AAH18115.1"
                     /db_xref="GeneID:6878"
                     /db_xref="HGNC:HGNC:11540"
                     /db_xref="MIM:602955"
                     /translation="MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVS
                     YRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGGGR
                     ELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAE
                     ATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSV
                     EQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNL
                     ALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAA
                     RLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLI
                     LPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRA
                     EFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLK
                     VPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGST
                     TTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSH
                     PSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP"
BASE COUNT          526 a          787 c          659 g          454 t
ORIGIN      
        1 cgccgagcgc cgggtgagca gcgtctcggc tgccgctaga gttttcctgc tccccgcgct
       61 cggctggcgg gggcgggtct gagtggtacc ccggaggaga ccctttgaag gtcccttgtg
      121 gggactggaa agaggacggg tctccgtctc tccaccgggg gcttcatcct tccagggagg
      181 agaagaggga ctccagaatg gctgaggaga agaagctgaa gcttagcaac actgtgctgc
      241 cctcggagtc catgaaggtg gtggctgaat ccatgggcat cgcccagatt caggaggaga
      301 cctgccagct gctaacggat gaggtcagct accgcatcaa agagatcgca caggatgcct
      361 tgaagttcat gcacatgggg aagcggcaga agctcaccac cagtgacatt gactacgcct
      421 tgaagctaaa gaatgtcgag ccactctatg gcttccacgc ccaggagttc attcctttcc
      481 gcttcgcctc tggtgggggc cgggagcttt acttctatga ggagaaggag gttgatctga
      541 gcgacatcat caatacccct ctgccccggg tgcccctgga cgtctgcctc aaagctcatt
      601 ggctgagcat cgagggctgc cagccagcta tccccgagaa cccgccccca gctcccaaag
      661 agcaacagaa ggctgaagcc acagaacccc tgaagtcagc caagccaggc caggaggaag
      721 acggacccct gaagggcaaa ggtcaagggg ccaccacagc cgacggcaaa gggaaagaga
      781 agaaggcgcc gcccttgctg gagggggccc ccttgcgact gaagccccgg agcatccacg
      841 agttgtctgt ggagcagcag ctctactaca aggagatcac cgaggcctgc gtgggctcct
      901 gcgaggccaa gagggcggaa gccctgcaaa gcattgccac ggaccctgga ctgtatcaga
      961 tgctgccacg gttcagtacc tttatctcgg agggggtccg tgtgaacgtg gttcagaaca
     1021 acctggccct actcatctac ctgatgcgta tggtgaaagc gctgatggac aaccccacgc
     1081 tctatctaga aaaatacgtc catgagctga ttccagctgt gatgacctgc atcgtgagca
     1141 gacagttgtg cctgcgacca gatgtggaca atcactgggc actccgagac tttgctgccc
     1201 gcctggtggc ccagatctgc aagcatttta gcacaaccac taacaacatc cagtcccgga
     1261 tcaccaagac cttcaccaag agctgggtgg acgagaagac gccctggacg actcgttatg
     1321 gctccatcgc aggcttggct gagctgggac acgatgttat caagactctg attctgcccc
     1381 ggctgcagca ggaaggggag cggatccgca gtgtgctgga cggccctgtg ctgagcaaca
     1441 ttgaccggat tggagcagac catgtgcaga gcctcctgct gaaacactgt gctcctgttc
     1501 tggcaaagct gcgcccaccg cctgacaatc aggacgccta tcgggcagaa ttcgggtccc
     1561 ttgggcccct cctctgctcc caggtggtca aggctcgggc ccaggctgct ctgcaggctc
     1621 agcaggtcaa caggaccact ctgaccatca cgcagccccg gcccacgctg accctctcgc
     1681 aggccccaca gcctggccct cgcacccctg gcttgctgaa ggttcctggc tccatcgcac
     1741 ttcctgtcca gacactggtg tctgcacgag cggctgcccc accacagcct tcccctcctc
     1801 caaccaagtt tattgtaatg tcatcgtcct ccagcgcccc atccacccag caggtcctgt
     1861 ccctcagcac ctcggccccc ggctcaggtt ccaccaccac ttcgcccgtc accaccaccg
     1921 tccccagcgt gcagcccatc gtcaagttgg tctccaccgc caccaccgca ccccccagca
     1981 ctgctccctc tggtcctggg agtgtccaga agtacatcgt ggtctcactt cccccaacag
     2041 gggagggcaa aggaggcccc acctcccatc cttctccagt tcctcccccg gcatcgtccc
     2101 cgtccccact cagcggcagt gccctttgtg gggggaagca ggaggctggg gacagtcccc
     2161 ctccagctcc agggactcca aaagccaatg gctcccagcc caactccggc tcccctcagc
     2221 ctgctccgtg atgctccacc tgccagcccc cggattccca cacatgcaga cacgtacaca
     2281 cgtgcacgta cacacatgca tgcacgctaa gcggaaggaa gttgtagatt gcttccttca
     2341 tgtcactttc tttttagata ttgtacagcc agtttctcag aataaaagtt tggtttgtaa
     2401 gttctgaaaa aaaaaaaaaa aaaaaa
//