LOCUS       BC018024                 621 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens trafficking protein particle complex 2-like, mRNA
            (cDNA clone MGC:24820 IMAGE:4287920), complete cds.
ACCESSION   BC018024
VERSION     BC018024.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 621)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 621)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 35 Row: p Column: 7
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 7706428.
FEATURES             Location/Qualifiers
     source          1..621
                     /db_xref="H-InvDB:HIT000038223"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:24820 IMAGE:4287920"
                     /tissue_type="Brain, primitive neuroectodermal"
                     /clone_lib="NIH_MGC_56"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..621
                     /gene="TRAPPC2L"
                     /gene_synonym="HSPC176"
                     /db_xref="GeneID:51693"
                     /db_xref="HGNC:HGNC:30887"
     CDS             20..439
                     /gene="TRAPPC2L"
                     /gene_synonym="HSPC176"
                     /codon_start=1
                     /product="trafficking protein particle complex 2-like"
                     /protein_id="AAH18024.1"
                     /db_xref="GeneID:51693"
                     /db_xref="HGNC:HGNC:30887"
                     /translation="MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKIS
                     AMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRK
                     LHNSYTDVMCNPFYNPGDRIQSRAFDNMVTSMMIQVC"
BASE COUNT          159 a          165 c          173 g          124 t
ORIGIN      
        1 tggcgccgag cctcccaaga tggcggtgtg catcgcggtg attgccaagg agaattaccc
       61 cctctacatt cgcagcaccc ctacggagaa cgagctgaag ttccactaca tggtgcacac
      121 atctctggac gtggtggatg agaagatctc cgcaatgggg aaggccctgg tcgaccagag
      181 ggagctgtac ctgggcctgc tctaccccac ggaggactac aaggtatacg gctacgtcac
      241 caactccaag gtgaagtttg tcatggtggt agattcctcc aacacagccc ttcgagacaa
      301 cgaaattcgc agcatgttcc ggaagctaca caactcctac acagacgtga tgtgcaaccc
      361 cttctacaac ccgggggacc gcatccagtc cagggccttt gataacatgg tgacgtcgat
      421 gatgatacag gtgtgctgag tgagctgtgc tgccagccat cgcagaggag cccgcgcacg
      481 actgtggtgg ggccgtcggt ctgttctggt tgcctcttcc tgaatgggac gcctggggct
      541 ttcagggcag gcagctgtgc atgttctctc aactaaaggt cttgtgagag gcaaaaaaaa
      601 aaaaaaaaaa aaaaaaaaaa a
//