LOCUS       BC017934                 977 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens NudC domain containing 2, mRNA (cDNA clone MGC:23968
            IMAGE:4698187), complete cds.
ACCESSION   BC017934
VERSION     BC017934.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 977)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 977)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 36 Row: o Column: 23
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 40556270.
FEATURES             Location/Qualifiers
     source          1..977
                     /db_xref="H-InvDB:HIT000038202"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:23968 IMAGE:4698187"
                     /tissue_type="Testis, embryonal carcinoma"
                     /clone_lib="NIH_MGC_61"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..977
                     /gene="NUDCD2"
                     /db_xref="GeneID:134492"
                     /db_xref="HGNC:HGNC:30535"
     CDS             88..561
                     /gene="NUDCD2"
                     /codon_start=1
                     /product="NudC domain containing 2"
                     /protein_id="AAH17934.1"
                     /db_xref="GeneID:134492"
                     /db_xref="HGNC:HGNC:30535"
                     /translation="MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQ
                     CGLQSRHVALSVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTS
                     LLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK"
BASE COUNT          302 a          174 c          244 g          257 t
ORIGIN      
        1 ggagaggccg aggcgtagcc taagcgtggg attccgcgcg tgcgctcggc tccgcctggt
       61 gcggccgcgg ccgggaggga ctggattatg tcggccccgt ttgaggagcg gagtggggtg
      121 gtaccgtgcg ggaccccgtg gggccagtgg taccagacct tggaggaggt gttcattgaa
      181 gttcaggtgc cgccaggcac gcgcgcccag gatatccagt gcggcctcca gagccggcat
      241 gtggcgctgt cggtgggcgg ccgcgagatc ctcaagggca aactctttga ttctacaata
      301 gctgatgagg gaacatggac tttggaggac agaaaaatgg ttcgtattgt tcttacaaag
      361 acaaagagag atgcagcaaa ttgttggact tctctactag aatctgaata tgcagcggat
      421 ccttgggtgc aagaccaaat gcagagaaag cttacattag agagattcca aaaagaaaat
      481 cctggttttg acttcagtgg agcagaaatc tcaggaaact acactaaagg tggaccagat
      541 ttctcaaacc ttgagaaata actgcttttt ttcctgcatt ctgtggatcc tagcagatat
      601 tgccaactta atcagataaa cagattatgt aatggaagaa aaatgcggat gcctacagtt
      661 aacagattgc aaaatgtatc ttaaaatggt tctaaaaatt gcattcaaac ataatttaca
      721 taggaaatgt actgtgggaa ctattctatg gatatatggt aaagttgttt tggacttgtt
      781 tttgctcagc atgaagtttt atatgctgca ttttactaat tccatattta accatatttt
      841 taatacaaaa gaacattaga gtatagatca tgtgaaatga agggtgcctt tggggaaaat
      901 taactttttc ttttgataag tatgatattc aataaaattt tctaaataaa aaaaaaaaaa
      961 aaaaaaaaaa aaaaaaa
//