LOCUS       BC017495                1396 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transmembrane emp24 protein transport domain
            containing 3, mRNA (cDNA clone MGC:17995 IMAGE:3921858), complete
            cds.
ACCESSION   BC017495
VERSION     BC017495.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1396)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1396)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-NOV-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 15 Row: o Column: 5.
FEATURES             Location/Qualifiers
     source          1..1396
                     /db_xref="H-InvDB:HIT000038035"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:17995 IMAGE:3921858"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_72"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1396
                     /gene="TMED3"
                     /gene_synonym="P24B"
                     /db_xref="GeneID:23423"
                     /db_xref="HGNC:HGNC:28889"
     CDS             100..753
                     /gene="TMED3"
                     /gene_synonym="P24B"
                     /codon_start=1
                     /product="transmembrane emp24 protein transport domain
                     containing 3"
                     /protein_id="AAH17495.1"
                     /db_xref="GeneID:23423"
                     /db_xref="HGNC:HGNC:28889"
                     /translation="MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEE
                     VEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCF
                     SNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTH
                     YRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS"
BASE COUNT          302 a          392 c          401 g          301 t
ORIGIN      
        1 ccccttacat cctcctaaga cccggtcggt agtcgtcgcc ccagcccgcc gggggcgcag
       61 cgcccgagcc gcggccctcg agacgggacc gagagcatca tgggcagcac tgtcccgcgc
      121 tccgcctccg tgctgcttct gctgctgctc ctgcgccggg ccgagcagcc ctgcggggcc
      181 gagctcacct tcgagctgcc ggacaacgcc aagcagtgct tccacgagga ggtggagcag
      241 ggcgtgaagt tctccctgga ttaccaggtc atcactggag gccactacga tgttgactgc
      301 tatgtagagg acccccaggg gaacaccatc tacagagaaa cgaagaagca gtacgacagc
      361 ttcacgtacc gggctgaagt caagggcgtt tatcagtttt gcttcagtaa tgagttttcc
      421 accttctctc acaagaccgt ctactttgac tttcaagtgg gcgatgagcc tcccattctc
      481 ccagacatgg ggaacagggt cacagctctc acccagatgg agtccgcctg cgtgaccatc
      541 catgaggctc tgaaaacggt gattgactcc cagacgcatt accggctgcg ggaggcccag
      601 gaccgggccc gagcggaaga ccttaatagc cgagtctctt actggtctgt tggcgagacg
      661 attgccctgt tcgtggtcag cttcagtcag gtgctactgt tgaaaagctt cttcacagaa
      721 aaacgaccca tcagcagggc agtccactcc tagccccggc atcctgctct agggcccctc
      781 atgccccagg ctggagcagc tctcctaggt cacagcctgc tgggctgggt cgcgtagccc
      841 agggtggagg cagaacgatg ctgctgtggt agccctttgc ctttcatgcc catgcttgat
      901 tcttgcacct cagcagctga aggtctcaga gaccagtaat cagaaggcat ccgactgcat
      961 taagtgtgca gcgctgaaaa gacatttaca actaggccag ggattagcca ctgtgggagg
     1021 gtggacaggc aatggttcag tggcctggct gttggcagga actccaagtg cccaggcctc
     1081 ttgggcagct tagggccctg cctctgtttc atgatgcatg ggtcatttgt cttgggtgtc
     1141 ctatcccata tggagaagaa aggggctcta agttctggct cttctttctt tggggttctc
     1201 tgtacctgag gaaaccaggc cctgggtgac tttgcagatc tgctcaccct cggtgagcaa
     1261 cagtgtcagc catgcaagca ggacagaatg gtgactgggt gcccttggtg agctgtgtat
     1321 ttcctaggag gtagaaaact gtgggaaact gtggctaata aaaactaagt gtgagcgtca
     1381 aaaaaaaaaa aaaaaa
//