LOCUS       BC017367                2061 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transmembrane protein 115, mRNA (cDNA clone MGC:1238
            IMAGE:3010216), complete cds.
ACCESSION   BC017367
VERSION     BC017367.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2061)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2061)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-NOV-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC017367.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 3 Row: e Column: 24
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 40795669.
FEATURES             Location/Qualifiers
     source          1..2061
                     /db_xref="H-InvDB:HIT000037973"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:1238 IMAGE:3010216"
                     /tissue_type="Muscle, rhabdomyosarcoma"
                     /clone_lib="NIH_MGC_17"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2061
                     /gene="TMEM115"
                     /gene_synonym="PL6"
                     /db_xref="GeneID:11070"
                     /db_xref="HGNC:HGNC:30055"
                     /db_xref="MIM:607069"
     CDS             400..1455
                     /gene="TMEM115"
                     /gene_synonym="PL6"
                     /codon_start=1
                     /product="transmembrane protein 115"
                     /protein_id="AAH17367.1"
                     /db_xref="GeneID:11070"
                     /db_xref="HGNC:HGNC:30055"
                     /db_xref="MIM:607069"
                     /translation="MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGC
                     LAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFF
                     SVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLR
                     VPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDM
                     ADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTD
                     PQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKG
                     AAPESSLITFEAAPPTL"
BASE COUNT          388 a          666 c          613 g          394 t
ORIGIN      
        1 gcgggagctg accaggcttg actcgggtac agaacgaggc accagtcccc ttgcgaaccg
       61 aagggcctcg cagtggatgg aggaggccca gccctgaggt caacgccaac caggctagcc
      121 tggcacgggg cctacagggt gggtaggcgg gcgtgccgca gccgtccagg gccttccctc
      181 aggtcccggg cgaggggcct acgctgcggc ccggcaacaa ggcccgactc ggcccctcgg
      241 gaccagagcc ccacccgatc ggaagcggat cctttaccag ggccataggc cagtgactag
      301 gccgggcctg ggcctcccat cggggccgga ctaggacgag gccccgggga ggcccctggc
      361 ctaccagacc cttttctcag gccgacagcc gccaggaaga tgcaacgtgc cctgccaggc
      421 gcccgccagc acttgggggc cattctggcc agcgccagcg tggtggtgaa ggctctgtgt
      481 gcggcggtac tattcctcta cctgctctcc ttcgccgtgg acacaggctg cctggcggtc
      541 accccgggct acctctttcc tcccaacttc tggatctgga ccctggccac ccatgggctg
      601 atggagcagc atgtgtggga cgtggccatc agcctgacaa cggtggtggt ggccgggcgt
      661 ttgctggagc ccctctgggg ggccttggag ctgctcatct tcttctcagt ggtgaatgtg
      721 tctgtagggc tgctgggggc cttcgcctac ctcctcacct acatggcttc cttcaacctg
      781 gtctacctgt tcactgtccg tatccacggc gccttgggct tcctaggtgg cgtcctggtg
      841 gcactcaagc aaaccatggg ggactgtgtg gtcctgcgag tgccccaggt gcgcgtcagt
      901 gtgatgccca tgctgctgct ggcgctgctg ctcctgctgc ggctcgccac gctgctccag
      961 agcccggcgc tggcttccta tggcttcggg ctgctctcca gttgggtata tcttcgcttc
     1021 taccagcgcc atagccgggg ccgaggggac atggctgacc actttgcttt cgccactttc
     1081 ttccctgaga tcctgcagcc tgtggtgggt ttgctggcga acttggtgca cagcctcctg
     1141 gtgaaggtaa agatatgcca gaagacggtg aagcgctacg atgtgggtgc cccatcctcc
     1201 atcaccatca gcctgccagg cacagaccct caagacgccg agcggagaag gcaactggcc
     1261 ctgaaggcac tcaatgagcg gctgaagaga gtggaagacc agtccatctg gcccagcatg
     1321 gatgatgatg aagaggagtc tggggccaag gtggacagcc ccctgccctc agacaaagct
     1381 cccacacccc cagggaaggg ggctgcccca gaatccagtc taatcacctt cgaggcagct
     1441 cccccgacgc tgtaactcca gaccaccttg agtgtggcac ctcccctccc aagcccccct
     1501 tgacatcctc tcagctactc cagggcacct gactgctctg aggagaggga agaaggcctg
     1561 ctggggcttt ccatggcctt ctgctgtttc tcgccaacac tacccaggac tcttgctacc
     1621 tggttccaac tccagacaac cactatgcca ggcccggagc ctctgaggca tcggccagtc
     1681 caggccctca tctgaggtaa gaatgtacat cagctggcag ccccaagcaa gtggctgcag
     1741 ggacactgat gccacagctc ctgggccggc cctcacatct gaaactggtt gccgagagcc
     1801 ctgagccaag gcaaggattt gccaaaaatg ttctgggggc ccagcaaatg caggagccga
     1861 cctggggctg cacatccctg cccatcccca gaaagactgt tcctgtcagg atttgtttcc
     1921 ctctgctgtg gcggtgactg cttctggacc agaacagctc cagctcccag gtattttcta
     1981 caggaccact tgagtgggca gccaagccca ggctcgcagt atcaataaag cagttctctg
     2041 agaaaaaaaa aaaaaaaaaa a
//