LOCUS       BC017364                2579 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transducin-like enhancer of split 2 (E(sp1) homolog,
            Drosophila), mRNA (cDNA clone MGC:10518 IMAGE:3925626), complete
            cds.
ACCESSION   BC017364
VERSION     BC017364.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2579)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2579)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-NOV-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 20, 2003 this sequence version replaced BC017364.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 14 Row: f Column: 2
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 34147648.
FEATURES             Location/Qualifiers
     source          1..2579
                     /db_xref="H-InvDB:HIT000037970"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:10518 IMAGE:3925626"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_21"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2579
                     /gene="TLE2"
                     /gene_synonym="ESG"
                     /gene_synonym="ESG2"
                     /gene_synonym="GRG2"
                     /db_xref="GeneID:7089"
                     /db_xref="HGNC:HGNC:11838"
                     /db_xref="MIM:601041"
     CDS             121..2352
                     /gene="TLE2"
                     /gene_synonym="ESG"
                     /gene_synonym="ESG2"
                     /gene_synonym="GRG2"
                     /codon_start=1
                     /product="transducin-like enhancer of split 2 (E(sp1)
                     homolog, Drosophila)"
                     /protein_id="AAH17364.1"
                     /db_xref="GeneID:7089"
                     /db_xref="HGNC:HGNC:11838"
                     /db_xref="MIM:601041"
                     /translation="MYPQGRHPTPLQSGQPFKFSILEICDRIKEEFQFLQAQYHSLKL
                     ECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLSGICAQIIPFLTQEHQQQ
                     VLQAVERAKQVTVGELNSLIGQQLQPLSHHAPPVPLTPRPAGLVGGSATGLLALSGAL
                     AAQAQLAAAVKEDRAGVEAEGSRVERAPSRSASPSPPESLVEEERPSGPGGGGKQRAD
                     EKEPSGPYESDEDKSDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLA
                     SSLGSPLPRAKELILNDLPASTPASKSCDSSPPQDASTPGPSSASHLCQLAAKPAPST
                     DSVALRSPLTLSSPFTTSFSLGSHSTLNGDLSVPSSYVSLHLSPQVSSSVVYGRSPVM
                     AFESHPHLRGSSVSSSLPSIPGGKPAYSFHVSADGQMQPVPFPSDALVGAGIPRHARQ
                     LHTLAHGEVVCAVTISGSTQHVYTGGKGCVKVWDVGQPGAKTPVAQLDCLNRDNYIRS
                     CKLLPDGRSLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAVSPDAKVCFSCC
                     SDGNIVVWDLQNQTMVRQFQGHTDGASCIDISDYGTRLWTGGLDNTVRCWDLREGRQL
                     QQHDFSSQIFSLGHCPNQDWLAVGMESSNVEILHVRKPEKYQLHLHESCVLSLKFASC
                     GRWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYE
                     VVY"
BASE COUNT          506 a          869 c          733 g          471 t
ORIGIN      
        1 ctctctcctc cctctttctt cgggcagcct ccccaccacc ccacttcagc ctcccccact
       61 cttgccgcct ccatatcatc aagctctggt ggcgcctggg gggcttttcg gatcggcagg
      121 atgtaccccc agggaaggca cccgaccccg ctccagtccg gccagccctt caagttctcg
      181 atcttggaga tctgcgaccg catcaaagaa gaattccagt ttcttcaggc tcaataccac
      241 agcctcaagc tagaatgtga gaagctggcc agcgagaaga cggaaatgca gcgacattat
      301 gtcatgtatt atgagatgtc gtacgggctc aacattgaaa tgcataagca ggcggagatt
      361 gtgaagcgtc tgagcggtat ctgcgctcag attatcccct tcctgaccca ggagcatcag
      421 cagcaggtgc tccaggccgt agaacgcgcc aagcaggtca ccgtggggga gctgaacagc
      481 ctcatcgggc agcagctcca gccgctgtcc caccacgcac cccctgtgcc cctcaccccc
      541 cgcccagccg ggctggtggg cggcagtgct acggggctgc ttgctctgtc tggagccctg
      601 gctgcccagg ctcagctggc ggcggctgtc aaggaggacc gtgcgggcgt ggaggccgag
      661 gggtccagag tggagagagc cccgagcagg agtgcatctc cctcgccccc tgagagtctc
      721 gtggaggagg agcgaccgag tggccctggt ggtggcggga agcagagagc agatgagaag
      781 gagccatcag gaccttatga aagcgacgaa gacaagagtg attacaatct ggtggtggac
      841 gaggaccaac cctcagagcc ccccagcccg gctaccaccc cctgcggaaa ggtacccatc
      901 tgcattcctg cccgtcggga cctggtggac agtccagcct ccttggcctc tagccttggc
      961 tcaccgctgc ctagagccaa ggagctcatc ctgaatgacc ttcccgccag cactcctgcc
     1021 tccaaatcct gtgactcctc cccgccccag gacgcttcca cccccgggcc cagctcggcc
     1081 agtcacctct gccagcttgc tgccaagcca gcaccttcca cggacagcgt cgccctgagg
     1141 agccccctga ctctgtccag tcccttcacc acgtccttca gcctgggctc ccacagcact
     1201 ctcaacggag acctctccgt gcccagctcc tacgtcagcc tccacctgtc cccccaggtc
     1261 agcagctctg tggtgtacgg acgctccccc gtgatggcat ttgagtctca tccccatctc
     1321 cgagggtcat ccgtctcttc ctccctaccc agcatccctg ggggaaagcc ggcctactcc
     1381 ttccacgtgt ctgcggacgg gcagatgcag ccggttccct tcccctcgga tgcactggta
     1441 ggcgcgggca tcccgcggca cgcccggcag ctgcacacgc tggcccatgg cgaggtggtc
     1501 tgcgcggtca ccatcagcgg ctccacacag catgtgtaca cgggcggcaa gggctgtgtg
     1561 aaggtgtggg acgtgggcca gcctggggcc aagacgcccg tggcccagct cgactgcctg
     1621 aaccgagaca actacattcg ttcctgcaag ttgctgccgg atggccggag tctgatcgtg
     1681 ggcggtgagg ccagcacctt gtccatttgg gacctggcgg cgcccacccc ccgtatcaag
     1741 gccgagctga cttcctcagc cccagcctgc tacgccctgg ccgtcagccc cgacgccaag
     1801 gtttgcttct cctgctgcag cgatggcaac attgtggtct gggacctgca gaatcagact
     1861 atggtcaggc agttccaggg ccacacggac ggcgccagct gcattgatat ttccgattac
     1921 ggcactcggc tctggacagg gggcctggac aacacggtgc gctgctggga cctgcgggag
     1981 ggccgccagc tgcagcagca tgacttcagc tcccagattt tctccctggg ccactgccct
     2041 aaccaggact ggctggcggt cggaatggag agtagcaacg tggagatcct gcacgtccgc
     2101 aagccggaga aataccagct gcacctccac gagagctgcg tgctgtccct gaagtttgcc
     2161 tcctgcggac ggtggtttgt gagcaccggg aaggacaacc tgctcaacgc ctggaggacg
     2221 ccgtacgggg ccagcatttt ccagtccaag gagtcgtcct cagtcctgag ttgtgacatc
     2281 tccagaaata acaaatacat cgtgacaggc tcgggggaca agaaggccac cgtgtatgag
     2341 gtggtctact gagacatgac cccccttcct gtacccgaag tccagactcc caggggaatc
     2401 agcagccagg acagacatcc tagcagccgc ctcccagccc tgcctaggaa ccgtacatcc
     2461 catctgctct ctggccaacg gcttcacacc ttcccctgct gcatgtgggg gccgatgggc
     2521 aggggacctc ggtggaaata aaatgtatct atcacatccg caaaaaaaaa aaaaaaaaa
//