LOCUS       BC017192                1734 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens neugrin, neurite outgrowth associated, mRNA (cDNA
            clone MGC:811 IMAGE:3139180), complete cds.
ACCESSION   BC017192
VERSION     BC017192.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1734)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1734)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-NOV-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Sep 16, 2003 this sequence version replaced BC017192.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 4 Row: b Column: 23
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 49574506.
FEATURES             Location/Qualifiers
     source          1..1734
                     /db_xref="H-InvDB:HIT000089209"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:811 IMAGE:3139180"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_21"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1734
                     /gene="NGRN"
                     /gene_synonym="DSC92"
                     /gene_synonym="NEUGRIN"
                     /db_xref="GeneID:51335"
                     /db_xref="HGNC:HGNC:18077"
     CDS             633..1292
                     /gene="NGRN"
                     /gene_synonym="DSC92"
                     /gene_synonym="NEUGRIN"
                     /codon_start=1
                     /product="neugrin, neurite outgrowth associated"
                     /protein_id="AAH17192.1"
                     /db_xref="GeneID:51335"
                     /db_xref="HGNC:HGNC:18077"
                     /translation="MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTD
                     VIRRVLKSKFLPTLEQKLKQDQKVLKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLL
                     MPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPR
                     ELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYR
                     I"
BASE COUNT          420 a          423 c          484 g          407 t
ORIGIN      
        1 gtcgacatgg cggttaccct gagtctcttg ctgggcgggc gcgtttgcgc cgccgtcact
       61 cgctgtgggt tcgcgacccg gggggtggcg ggcccaggcc ctattggccg ggagccggac
      121 cccgattccg actgggagcc ggaggaacgg gagctgcagg aggtggagag gtaccggctt
      181 ctccccgggc cctcagcttg aagcagggcc tcgtgccccg gcgctccagg ccgcgccccc
      241 ttggcgccgg gtgtcctgcc gctgcttgcg cagcggccct tgtttcttct tacccgttgt
      301 taggggcgca gcgtcaggtg ttcagctccc cgggaccact ggtcccttca ttagtgacgt
      361 atttcatcat cagtttagag agttcggcat gcttacaggc agttattgtt ctaggtgtta
      421 gctttctggg tgtacggagc agctctaagc cggcaacatg gcccggttgc ccttgcgatc
      481 aaagagaaga gggctgggcg ctccatgatt tagcctgagg ctcttcaaac atccattctg
      541 cttccacgca tggcttctgc cattggttct cttcccccag caccctgaaa cgacagaaac
      601 aagcaatccg attccagaaa attcggaggc aaatggaggc gcctggtgcc ccgcccagga
      661 ccctgacgtg ggaagccatg gagcagatac ggtatttaca tgaggaattt ccagagtcct
      721 ggtcagttcc caggttggct gaaggctttg atgtcagcac tgatgtgatc cgaagagttt
      781 taaaaagcaa gtttttaccc acattggagc agaagctgaa gcaggatcaa aaagtcctta
      841 agaaagctgg gcttgcccac tcgctgcagc acctccgggg ctctggaaat acctcaaagc
      901 tgctccctgc aggccactct gtatcaggct ctttgcttat gccagggcat gaagcctcat
      961 ctaaagaccc aaatcacagc acagctttga aagtgataga gtcagacact cacaggacaa
     1021 atacaccaag gagaaggaag ggaagaaata aagaaatcca ggacctggag gagagctttg
     1081 tgcctgttgc tgcaccccta ggtcatccaa gagagctgca gaagtactcc agtgattctg
     1141 agagccccag aggaactggc agtggtgcgt tgccaagtgg tcagaagctg gaggagttga
     1201 aggcagagga gccagataac ttcagcagca aagtagtgca gaggggccga gagttctttg
     1261 acagcaacgg gaacttcctg tacagaattt gagtcggggc ttggcttatg gagatgcctc
     1321 gtgaaacaca gctgggcaag tattaatgta tatggaacag cctggatttc tgcatatgga
     1381 taagccacct tggaatagga agaggtgttg agcctggact gtgggaggaa agagctgcgt
     1441 ggatagattc aaacttcctg tggtagtgct cccagtctga cctctgtaga ccttcagtac
     1501 tcactcttct tgcttaggct ctctgtgtgt tgaaagccat cccgtgttgc atgtgttgtt
     1561 acaattttct gtgatacttg caatttatgt ttgagaagaa gtgaaaagtt tgccttctga
     1621 cctcatttcc ttcttgatca gtgaacacta acattttggg gacaacttag tcaattggtt
     1681 ttccttacaa caaaataaag taaaatgtag caaaaaaaaa aaaaaaaaaa aaaa
//