LOCUS       BC017188                3115 bp    mRNA    linear   HUM 06-OCT-2006
DEFINITION  Homo sapiens TEL2, telomere maintenance 2, homolog (S. cerevisiae),
            mRNA (cDNA clone MGC:1356 IMAGE:3139743), complete cds.
ACCESSION   BC017188
VERSION     BC017188.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3115)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3115)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-NOV-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Sep 16, 2003 this sequence version replaced BC017188.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 4 Row: a Column: 12
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 7705345.
FEATURES             Location/Qualifiers
     source          1..3115
                     /db_xref="H-InvDB:HIT000037860"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:1356 IMAGE:3139743"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_21"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..3115
                     /gene="TELO2"
                     /gene_synonym="c305C8.3"
                     /gene_synonym="DKFZp434A073"
                     /gene_synonym="hCLK2"
                     /gene_synonym="KIAA0683"
                     /db_xref="GeneID:9894"
                     /db_xref="HGNC:HGNC:29099"
     CDS             48..2561
                     /gene="TELO2"
                     /gene_synonym="c305C8.3"
                     /gene_synonym="DKFZp434A073"
                     /gene_synonym="hCLK2"
                     /gene_synonym="KIAA0683"
                     /codon_start=1
                     /product="TEL2, telomere maintenance 2, homolog (S.
                     cerevisiae)"
                     /protein_id="AAH17188.1"
                     /db_xref="GeneID:9894"
                     /db_xref="HGNC:HGNC:29099"
                     /translation="MEPAPSEVRLAVREAIHALSSSEDGGHIFCTLESLKRYLGEMEP
                     PALPREKEEFASAHFSPVLRCLASRLSPAWLELLPHGRLEELWASFFLEGPADQAFLV
                     LMETIEGAAGPSFRLMKMARLLARFLREGRLAVLMEAQCRQQTRPGFILLRETLLGKV
                     VALPDHLGNRLQQENLAEFFPQNYFRLLGEEVVRVLQAVVDSLQGGLDSSVSFVSQVL
                     GKACVHGRQQEILGVLVPRLAALTQGSYLHQRVCWRLVEQVPDRAMEAVLTGLVEAAL
                     GPEVLSRLLGNLVVKNKKAQFVMTQKLLFLQSRLTTPMLQSLLGHLAMDSQRRPLLLQ
                     VLKELLETWGSSSAIRHTPLPQQRHVSKAVLICLAQLGEPELRDSRDELLASMMAGVK
                     CRLDSSLPPVRRLGMIVAEVVSARIHPEGPPLKFQYEEDELSLELLALASPQPAGDGA
                     SEAGTSLVPATAEPPAETPAEIVDGGVPQAQLAGSDSDLDSDDEFVPYDMSGDRELKS
                     SKAPAYVRDCVEALTTSEDIERWEAALRALEGLVYRSPTATREVSVELAKVLLHLEEK
                     TCVVGFAGLRQRALVAVTVTDPAPVADYLTSQFYALNYSLRQRMDILDVLTLAAQELS
                     RPGCLGRTPQPGSPSPNTPCLPEAAVSQPGSAVASDWRVVVEERIRSKTQRLSKGGPR
                     QGPAGSPSRFNSVAGHFFFPLLQRFDRPLVTFDLLGEDQLVLGRLAHTLGALMCLAVN
                     TTVAVAMGKALLEFVWALRFHIDAYVRQGLLSAVSSVLLSLPAARLLEDLMDELLEAR
                     SWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPASP"
BASE COUNT          545 a          974 c         1050 g          546 t
ORIGIN      
        1 gccgggtcca ggtcgtcttc ccgtgacgcc cagatctgtc ctgcaggatg gagccagcac
       61 cctcagaggt tcgactcgcc gtccgggaag ccattcatgc cctctcgtct tcggaggatg
      121 gcggccacat cttctgcacc ctggagtccc tgaagcggta tctcggtgag atggagcctc
      181 cagcgctccc gagggagaag gaggagtttg cctcggccca cttctcgcct gtcctcagat
      241 gtcttgccag caggctgagc ccagcctggc tggagctgct gccccatggc cgcctggagg
      301 agctgtgggc cagcttcttc ctggagggcc cggcggacca agccttcctg gtgttgatgg
      361 agaccatcga gggtgctgcg ggccccagct tccggctgat gaagatggcg cggctgctgg
      421 ccagattcct gcgcgagggc cggctggcag tgctgatgga ggcgcagtgt cggcagcaga
      481 cgcggcccgg cttcatcctg ctccgggaga cgctgctggg caaggtggtg gccctgcccg
      541 atcacctggg caaccgcctg cagcaggaga acttggccga gttcttcccc cagaactact
      601 tccgcctgct cggcgaggag gtcgtccggg tgctgcaggc ggttgtggac tctctccaag
      661 gtggcctgga ttcctccgtg tccttcgtgt ctcaggtcct tgggaaagcc tgtgtccacg
      721 ggaggcagca ggagatcctg ggcgtgctgg taccccggct ggcagcgctc acccagggca
      781 gctacctgca ccagcgcgtc tgctggcgcc tggtggagca agtgccggac cgggccatgg
      841 aggctgtgct gaccgggctg gtggaggccg cactggggcc tgaggtcctt tcgagactgc
      901 tggggaacct ggtggtgaag aacaagaagg cccagtttgt gatgacccag aagcttctgt
      961 tcttacagtc ccggctcacg acgcccatgc tgcagagcct gctgggccat ctggccatgg
     1021 acagccagcg gcgcccgctc ctgctgcagg tgctgaagga gctgttggag acgtggggca
     1081 gcagcagtgc catccgccac actcccctgc cgcagcagcg ccacgtcagc aaggctgtcc
     1141 tcatctgcct ggcgcaactc ggggagccgg aactgcggga cagccgggat gaactgctgg
     1201 ccagcatgat ggcgggcgtg aagtgccgcc tggacagtag cctgcccccc gtgcgacgcc
     1261 tgggcatgat cgtggcagag gtcgttagtg cccggatcca ccccgagggg cctcccctga
     1321 aattccagta cgaagaggat gaactgagcc tcgagctgct ggccttggcc tccccccagc
     1381 ctgcgggtga cggcgcctcg gaggcgggca cgtccctcgt tccagccacg gcagagcccc
     1441 ctgcagagac ccccgcagag atcgtggatg gcggcgtccc ccaagcacag ctggcgggct
     1501 ctgactcgga cctggacagc gatgatgagt ttgtccccta cgacatgtcg ggggacagag
     1561 agctgaagag cagcaaggct cctgcctacg tccgggactg cgtggaagcc ctgaccacgt
     1621 ctgaggacat agagcgctgg gaggcagccc tgcgggccct tgagggcctg gtctacagga
     1681 gccccacagc cactcgggag gtgagcgtgg agctggccaa ggtgcttctg catctggagg
     1741 agaagacctg tgtggtggga tttgcagggc tgcgccagag agccctggtg gccgtcacgg
     1801 tcacagaccc ggccccggtg gccgactatc tgacctcaca gttctatgcc ctcaactaca
     1861 gcctccggca gcgcatggac atcctggatg tgctgactct ggctgcccag gagctgtcta
     1921 ggcctgggtg cctcgggagg actccccaac ctggctcccc aagtcccaac accccgtgcc
     1981 tgccagaggc agccgtctct cagcctggca gtgccgtggc gtctgactgg cgggtggtgg
     2041 tggaggagcg gatcagaagc aagacccagc ggctctccaa gggtggcccg aggcagggcc
     2101 cggcaggcag ccccagcaga ttcaactccg tggccggcca cttcttcttc cccctccttc
     2161 agcgctttga caggcctctg gtgaccttcg acctcttggg agaagaccag ctggttctcg
     2221 gaaggctggc gcacacctta ggggccctga tgtgcctggc tgttaacacc acggtggctg
     2281 tggccatggg caaggccctg ctggaattcg tgtgggccct tcgcttccac atcgatgcct
     2341 acgtgcgcca ggggctgttg tcggccgtct cctccgtcct gctcagcctg cctgctgcgc
     2401 gcctgctgga ggacctgatg gacgagctgc tggaagcccg gtcctggctg gcggacgtgg
     2461 ctgagaaaga cccggacgag gactgcagga cgctggcact gagggccctg ctgcttctgc
     2521 agagactcaa gaacaggctc ctcccacccg cgtctcccta gtccctggag gcctccccag
     2581 gaccaccctc gccgacagca aggcaggcgg ctgagcagcg gcctggagca gcagagccag
     2641 gctttgtagc gaggccaggt cttcggccgc atccggtacg gagagtgcag atgcaggaag
     2701 gcccggcctg ccgctattta tagtgcagcc agtccgctaa aaatacactg ggcctgggca
     2761 ctgcccgccg ggacatggca gcctggacgt ggggctgggg ctgtgggcgc tgctggcggg
     2821 gttgactctt ccagtgaggg cagaaccagg ctggcaggag gggaggacgg tgtacctgct
     2881 gctcagagcc cccaaggctc tcctctgaga gccaccaagc aggacagagc agctcttgtc
     2941 ccaggtccct cgggctgagc gccgtgtcac caggagaata gtgctcacag cccaggcagg
     3001 gtgtgtggct cctggatggg ctcgtggggc gggatgggac agggcacggg ctctcagaaa
     3061 ataaactgct ttattggaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaa
//