LOCUS       BC016052                2873 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens NCK interacting protein with SH3 domain, mRNA (cDNA
            clone MGC:22962 IMAGE:4862348), complete cds.
ACCESSION   BC016052
VERSION     BC016052.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2873)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2873)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-OCT-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 34 Row: h Column: 16
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 37577147.
FEATURES             Location/Qualifiers
     source          1..2873
                     /db_xref="H-InvDB:HIT000037466"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:22962 IMAGE:4862348"
                     /tissue_type="Skin, melanotic melanoma, high MDR."
                     /clone_lib="NIH_MGC_49"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2873
                     /gene="NCKIPSD"
                     /gene_synonym="AF3P21"
                     /gene_synonym="DIP"
                     /gene_synonym="DIP1"
                     /gene_synonym="MGC23891"
                     /gene_synonym="ORF1"
                     /gene_synonym="SPIN90"
                     /gene_synonym="WASLBP"
                     /gene_synonym="WISH"
                     /db_xref="GeneID:51517"
                     /db_xref="HGNC:HGNC:15486"
                     /db_xref="MIM:606671"
     CDS             11..2158
                     /gene="NCKIPSD"
                     /gene_synonym="AF3P21"
                     /gene_synonym="DIP"
                     /gene_synonym="DIP1"
                     /gene_synonym="MGC23891"
                     /gene_synonym="ORF1"
                     /gene_synonym="SPIN90"
                     /gene_synonym="WASLBP"
                     /gene_synonym="WISH"
                     /codon_start=1
                     /product="NCK interacting protein with SH3 domain"
                     /protein_id="AAH16052.1"
                     /db_xref="GeneID:51517"
                     /db_xref="HGNC:HGNC:15486"
                     /db_xref="MIM:606671"
                     /translation="MYRALYAFRSAEPNALAFAAGETFLVLERSSAHWWLAARARSGE
                     TGYVPPAYLRRLQGLEQDVLQAIDRAIEAVHNTAMRDGGKYSLEQRGVLQKLIHHRKE
                     TLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGL
                     YQIPPQPRRAAPTTPPPPVKRRDREALMASGSGGHNTMPSGGNSVSSGSSVSSTSLDT
                     LYTSSSPSEPGSSCSPTPPPVPRRGTHTTVSQVQPPPSKASAPEPPAEEEVATGTTSA
                     SDDLEALGTLSLGTTEEKAAAEAAVPRTIGAELMELVRRNTGLSHELCRVAIGIIVGH
                     IQASVPASSPVMEQVLLSLVEGKDLSMALPSGQVCHDQQRLEVIFADLARRKDDAQQR
                     SWALYEDEGVIRCYLEELLHILTDADPEVCKKMCKRNEFESVLALVAYYQMEHRASLR
                     LLLLKCFGAMCSLDAAIISTLVSSVLPVELARDMQTDTQDHQKLCYSALILAMVFSMG
                     EAVPYAHYEHLGTPFAQFLLNIVEDGLPLDTTEQLPDLCVNLLLALNLHLPAADQNVI
                     MAALSKHANVKIFSEKLLLLLNRGDDPVRIFKHEPQPPHSVLKFLQDVFGSPATAAIF
                     YHTDMMALIDITVRHIADLSPGDKLRMEYLSLMHAIVRTTPYLQHRHRLPDLQAILRR
                     ILNEEETSPQCQMDRMIVREMCKEFLVLGEAPS"
BASE COUNT          614 a          923 c          792 g          544 t
ORIGIN      
        1 gcccggcctc atgtaccgcg cgctgtacgc gttccgctcg gcggagccca acgcgctggc
       61 gttcgccgcg ggcgagacct tcctggtgct agagcgaagc agcgcgcact ggtggctggc
      121 cgcgcgggcg cgcagtggtg agacgggcta cgtgccgcca gcctacctgc gccgcctgca
      181 gggcctggag caggatgtcc tccaggccat tgaccgggcc atcgaggctg tacacaacac
      241 agccatgcgg gatggtggca agtacagcct ggaacagcgt ggagtcctcc agaagctgat
      301 ccaccaccgg aaagagaccc tgtcacgcag aggcccttca gcctccagtg ttgcagttat
      361 gacctcatca accagtgacc accacttgga tgctgctgca gccaggcagc ccaatggggt
      421 gtgtcgagct gggttcgagc ggcagcacag cctacccagt tctgagcatc ttggggcaga
      481 tggaggcctc taccagatcc caccacagcc tcgccgagca gcacccacca caccgccccc
      541 accagtgaag cgccgagacc gcgaggccct gatggcctct gggagtggtg gccacaacac
      601 catgccctcc gggggtaact ctgtgtccag cggctcctca gtcagcagca cctccctgga
      661 cacgctctat accagctcca gcccatctga accaggctcc agctgctcac ccacaccccc
      721 acctgtgccc cgccgaggca cccacaccac cgtgtcccaa gtccagcccc ctccctccaa
      781 ggcatcagca cctgaacccc ctgcagaaga agaagtggca actggtacaa cctcagcctc
      841 tgatgacctg gaagccctgg gtacactgag cctggggacc acagaggaga aggcagcagc
      901 tgaggcggct gtgcccagga ccattggggc cgagctgatg gagctggtgc ggagaaacac
      961 tggcctgagc cacgaattat gccgggtggc catcggcatc atagtgggtc acatccaggc
     1021 ctcggtgccg gccagctcac cagtcatgga gcaggtcctc ctctcactcg tagagggcaa
     1081 ggacctcagc atggccctgc cctcagggca ggtctgccac gaccagcaga ggctggaggt
     1141 gatctttgca gacctggctc gccggaagga cgacgcccag cagcgcagtt gggcactata
     1201 tgaggatgag ggtgtcatcc gctgctacct agaggagctg ctgcatattc tgactgatgc
     1261 agaccctgaa gtttgcaaga aaatgtgcaa gagaaacgag ttcgagtctg tcctggcctt
     1321 ggtggcctat taccaaatgg aacaccgagc atcactgcgg ctgctgctcc tcaagtgctt
     1381 tggcgccatg tgcagcctgg atgcagccat catctccacg cttgtgtcat ccgtgctgcc
     1441 tgtagagctg gcgagggaca tgcagacaga cacgcaggac caccagaaac tctgttactc
     1501 tgccctcatc ctggccatgg tcttctccat gggagaggca gtgccctatg cacactatga
     1561 gcacctgggc acgcctttcg cccagttcct actgaacatc gtcgaggatg ggctgccctt
     1621 ggacaccaca gagcagctgc cggacctctg cgtgaacctg cttctggctc tcaacctgca
     1681 cctgccagct gctgaccaga atgtcatcat ggctgccctg agcaaacacg ccaatgtcaa
     1741 gatcttctcc gagaagctgt tgttgctcct gaacagaggg gatgaccctg tgcgcatctt
     1801 caaacatgag ccacagccac cacactctgt cctcaagttc ctgcaggacg tgtttggcag
     1861 cccggccaca gctgccatct tctaccacac agacatgatg gctctcattg acatcactgt
     1921 gcggcacatc gcagacctgt caccaggaga caagctgcgc atggagtacc tctccctgat
     1981 gcatgctata gtccgcacca caccctacct gcagcaccgc caccggctac ccgacctgca
     2041 ggccatactg cgacgcatcc tgaatgagga ggagacctca ccccagtgcc agatggaccg
     2101 catgattgtc cgagagatgt gcaaggaatt cctggtgctg ggggaggctc ccagctagca
     2161 ccttgctgtc ctcccttccc tgcagctcca gtcagtgtgc aggggactca ggggcttggc
     2221 cctaagaatg ttttgcactg acagtgggag gggataaggt ggcagaagga acctgagcag
     2281 gacccccacc tgaagtagaa cttaagagag gggccaagtg taggattggg gaccatggtc
     2341 tgggagctgt tctggggcag ggggaatatg caagctaaag cccctctata ccctggtagg
     2401 cttcctcttc agcatgcccc cctcttcacc ccacacccat gtgtacactc agagtcctgc
     2461 tgccgctcca ggctggacca gacccccatc cccacccctc ctggtctgta tcctgggcct
     2521 cagcaagcca tgcccctggg gtgaggggag gcatctccca ccagctctat tctttgcctt
     2581 agctttgcag tgagtgctgc tcatgtcctc ccctccaccc gcacatgggg gtcgctgccc
     2641 ttcactccta cccccagagg ccttggccaa gctgctgctt tgaaagcggg atcttggaga
     2701 caggccatcc atcctggagc ctcatggaac aggatgatgg cactgagaaa gccaatgacc
     2761 gaatctcttt tctctgtaaa aatgtagact gaaaagccat gtgtattttc ctatgtgctg
     2821 tagctctcct ttggaaataa atcacaggca tctggaaaaa aaaaaaaaaa aaa
//