LOCUS       BC016010                 910 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transmembrane protein 18, mRNA (cDNA clone MGC:27368
            IMAGE:4686355), complete cds.
ACCESSION   BC016010
VERSION     BC016010.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 910)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 910)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-OCT-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 38 Row: j Column: 23.
FEATURES             Location/Qualifiers
     source          1..910
                     /db_xref="H-InvDB:HIT000088895"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:27368 IMAGE:4686355"
                     /tissue_type="Lung, mucoepidermoid carcinoma"
                     /clone_lib="NIH_MGC_59"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..910
                     /gene="TMEM18"
                     /gene_synonym="DKFZp434C1714"
                     /db_xref="GeneID:129787"
                     /db_xref="HGNC:HGNC:25257"
     CDS             67..489
                     /gene="TMEM18"
                     /gene_synonym="DKFZp434C1714"
                     /codon_start=1
                     /product="transmembrane protein 18"
                     /protein_id="AAH16010.2"
                     /db_xref="GeneID:129787"
                     /db_xref="HGNC:HGNC:25257"
                     /translation="MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCL
                     SSRSYRLQIGHFLCLVILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLL
                     VNAMIIVVMWVWKTLNVMTDLKNAQERRKEKKRRRKED"
BASE COUNT          243 a          213 c          224 g          230 t
ORIGIN      
        1 gggggctctg tggattctgg ccaggccggg ttcggcggtt gctgtgagag cgggcttccc
       61 aacaccatgc cgtccgcctt ctctgtcagc tctttccccg tcagcatccc agccgtactc
      121 acgcagacgg actggactga gccctggctc atggggctgg ccaccttcca cgcgctctgc
      181 gtgctcctca cctgcttgtc ctcccgaagc tacagactac agatcgggca ctttctgtgt
      241 ctagtcatct tagtctactg tgctgaatac atcaatgagg cggctgcgat gaactggaga
      301 ttattttcga aataccagta tttcgactcc agggggatgt tcatttctat agtattttca
      361 gccccactgc tggtgaatgc catgatcatt gtggttatgt gggtatggaa gactttgaat
      421 gtgatgactg acctgaagaa tgcacaagag agaagaaagg aaaagaaaag gagaaggaaa
      481 gaagactgag gggcagcagc tgcttggagt ttgcgtcctt cccgtccacc cagtgcagct
      541 cccagtgctg cagtgtgcgt ggcgtgggca tccttccagc tgactcatgg tttgaaaaac
      601 cgttgtttta tttaaatatc cacagtggta gggcacacac tgaagttggc ttttcagcca
      661 gcactgaatg tatccatcag gacatgcgtc ttcaggtgcc tgatctttgt agtcaggctg
      721 tgggaacggt ctctgcagag cttcataact gggaatttga tttgaagaag tccatgtcat
      781 atgtgtaact agtactaatt ataaatataa aatacacaat ataaaatatg aaactcaata
      841 ataaacagtg ccacctgtac atgggcacca tgccctcccc aaaaaaaaaa aaaaaaaaaa
      901 aaaaaaaaaa
//