LOCUS       BC015747                3015 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transducin-like enhancer of split 1 (E(sp1) homolog,
            Drosophila), mRNA (cDNA clone MGC:23047 IMAGE:4857394), complete
            cds.
ACCESSION   BC015747
VERSION     BC015747.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3015)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3015)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 34 Row: e Column: 15
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 34147712.
FEATURES             Location/Qualifiers
     source          1..3015
                     /db_xref="H-InvDB:HIT000037293"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:23047 IMAGE:4857394"
                     /tissue_type="Colon, adenocarcinoma"
                     /clone_lib="NIH_MGC_15"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..3015
                     /gene="TLE1"
                     /gene_synonym="ESG"
                     /gene_synonym="ESG1"
                     /gene_synonym="GRG1"
                     /db_xref="GeneID:7088"
                     /db_xref="HGNC:HGNC:11837"
                     /db_xref="MIM:600189"
     CDS             152..2464
                     /gene="TLE1"
                     /gene_synonym="ESG"
                     /gene_synonym="ESG1"
                     /gene_synonym="GRG1"
                     /codon_start=1
                     /product="transducin-like enhancer of split 1 (E(sp1)
                     homolog, Drosophila)"
                     /protein_id="AAH15747.1"
                     /db_xref="GeneID:7088"
                     /db_xref="HGNC:HGNC:11837"
                     /db_xref="MIM:600189"
                     /translation="MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLK
                     LECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQ
                     QVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGG
                     SAGLLALSSALSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGP
                     EFSNDIKKRKVDDKDSSHYDSDGDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKN
                     RLLKKDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSAT
                     PGLRPGLGKPPAIDPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYA
                     SLHNMSPQMSAAAAAAAVVAYGRSPMVGFDPPPHMRVPTIPPNLAGIPGGKPAYSFHV
                     TADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVK
                     VWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRI
                     KAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDI
                     SNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVE
                     VLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESS
                     SVLSCDISVDDKYIVTGSGDKKATVYEVIY"
BASE COUNT          773 a          834 c          764 g          644 t
ORIGIN      
        1 ccggtgcgcc cggcggagcg cgcgtgcgtg gccagcgcgc tccccgcttc tgcttggctt
       61 tccggcttaa ttttcctcgg cgggattaaa gttggaaatt gaccggagaa ttgagttgcc
      121 ggggaacaga gccccggccg ccgccagagc gatgttcccg cagagccggc acccgacgcc
      181 gcaccaggct gcaggccagc ccttcaagtt cactatcccg gagtccctgg accggattaa
      241 agaggaattc cagttcctgc aggcgcagta tcacagcctt aaattggaat gtgagaaact
      301 ggcaagtgaa aagacagaaa tgcagaggca ctatgtgatg tattatgaaa tgtcatatgg
      361 attaaacatt gaaatgcaca aacagactga aatcgccaag agattgaata cgatttgtgc
      421 acaagtcatc ccatttctgt ctcaggaaca tcaacaacag gtggcccagg ctgttgaacg
      481 tgccaaacag gtgaccatgg cagagttgaa tgccatcatc gggcagcagc agttgcaagc
      541 tcagcatctt tctcatggcc acggaccccc agttcccctt acgcctcacc cttcgggact
      601 tcagcctcct ggaatcccgc ccctcggggg cagtgccggc cttcttgcgc tgtccagtgc
      661 tctgagtggg cagtctcact tggcaataaa agatgacaag aagcaccacg atgcagagca
      721 ccacagagac agagagccgg gcacaagtaa ttccctcctg gtcccagaca gtctaagagg
      781 cacagataaa cgcagaaatg gacctgaatt ttccaatgac atcaagaaaa ggaaggtgga
      841 tgataaggac tccagccact atgacagtga tggtgacaaa agcgatgaca acttagttgt
      901 ggatgtgtct aatgaggacc cttcttctcc gcgagcaagc cctgcccact cgccccggga
      961 aaatggaatc gacaaaaatc gcctgctaaa gaaggatgct tctagcagtc cagcttccac
     1021 ggcctcctcg gcaagttcca cttctttgaa atccaaagaa atgagcttgc atgaaaaagc
     1081 cagcacgcct gttctgaaat ccagcacacc aacgcctcgg agcgacatgc caacgccggg
     1141 caccagcgcc actccaggcc tccgtccagg tctcggcaag cctccagcca tagaccccct
     1201 cgttaaccaa gcggcagctg gcttgaggac acccctggca gtgcccggcc catatcctgc
     1261 tccttttggg atggtccccc acgctggcat gaacggcgag ctgaccagcc caggcgctgc
     1321 ctacgccagt ttacacaaca tgtcgcccca gatgagcgcc gcagccgccg cggccgccgt
     1381 ggtggcctac gggcgctccc ccatggtggg gtttgatcct ccccctcaca tgagagtacc
     1441 taccattcct ccaaacctgg caggaatccc tggggggaaa cctgcatact ccttccacgt
     1501 tactgcagac ggtcagatgc agcctgtccc ttttcccccc gacgccctca tcggacccgg
     1561 aatcccccgg catgctcgcc agatcaacac cctcaaccac ggggaggtgg tgtgcgctgt
     1621 gaccatcagc aaccccacga gacacgtgta cacaggcggg aagggctgcg tcaaggtctg
     1681 ggacatcagc caccctggca ataagagccc tgtctcccag ctcgactgtc tgaacagaga
     1741 caattatatc cgttcctgta aattgctacc cgatggctgc actctcatag tgggagggga
     1801 agccagtact ttgtccattt gggacctggc ggctccaacc ccgcgcatca aggcggagct
     1861 gacgtcctcg gcccccgcct gctacgccct ggccatcagc cccgattcca aggtctgctt
     1921 ctcatgctgc agcgacggca acatcgctgt gtgggatctg cacaaccaga cactagtgag
     1981 gcaattccag ggccacacag acggagccag ctgtattgac atttctaatg atggcaccaa
     2041 gctctggacg ggtggtttgg acaacacagt caggtcctgg gacctgcgcg aggggcggca
     2101 gctgcagcag cacgacttca cctcccagat cttctccctg gggtactgcc ccaccgggga
     2161 gtggctggca gtgggcatgg agagcagcaa tgtggaggtg ctgcacgtga acaagcctga
     2221 caagtaccag ctgcacctgc atgagagctg cgtgctgtcc ctgaaatttg cttactgtgg
     2281 taaatggttt gtgagtactg gaaaagataa cctcctcaat gcttggcgga ccccctatgg
     2341 agccagcata ttccagtcca aagagtcctc gtcagtgctt agctgtgaca tctctgtgga
     2401 tgataagtac atagtcactg gctcggggga caagaaggct acagtctatg aagtcatcta
     2461 ctgaaaacat tatgtggttt aacgtttata gttgaattgg gccaaaatgt ttcgaattta
     2521 tagaaataga aaagttgtaa ctttaaaaga gaaaaaaaat tacaaacacc tgtttccaaa
     2581 ccttgacaga aaactacttt gagtctacaa agaggaggcg acaagtccat cagcagaaag
     2641 tcacctgtct acatagacca aatggagcac caaggccaag cggacagagg ggccatgggt
     2701 tgtaggattg aggaacggaa tctgccgact cacatgacag cccattcttt ctttctgggt
     2761 gatctgggga tcacgccttg cccaagtgtg agattacctt tctgttcctt gcagttcacc
     2821 tcactttccg tcctttgtag agcagtggtg tctccaatga acttgtttcc tggttttgca
     2881 tcttgtgaaa tgtttttttg tatttttgtt gaaggttaaa catttgtata aattgtaaat
     2941 atatttggtt tattacagta aaggctttag taccaataaa aaaaaaaaaa aaaaaaaaaa
     3001 aaaaaaaaaa aaaaa
//