LOCUS       BC015632                2713 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens chromosome 7 open reading frame 27, mRNA (cDNA clone
            MGC:22916 IMAGE:3839985), complete cds.
ACCESSION   BC015632
VERSION     BC015632.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2713)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2713)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Dec 19, 2003 this sequence version replaced gi:18182862.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 33 Row: a Column: 16
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 52851444.
FEATURES             Location/Qualifiers
     source          1..2713
                     /db_xref="H-InvDB:HIT000037229"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:22916 IMAGE:3839985"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_21"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2713
                     /gene="C7orf27"
                     /gene_synonym="MGC22916"
                     /db_xref="GeneID:221927"
                     /db_xref="HGNC:21701"
     CDS             43..2508
                     /gene="C7orf27"
                     /gene_synonym="MGC22916"
                     /codon_start=1
                     /product="chromosome 7 open reading frame 27"
                     /protein_id="AAH15632.2"
                     /db_xref="GI:22800645"
                     /db_xref="GeneID:221927"
                     /db_xref="HGNC:21701"
                     /translation="MDPECAQLLPALCAVLVDPGQPVADDTCLEKLLDWFKTVTEGES
                     SVVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGL
                     FGEPGPLGRATWAVPTVRSGWIQGLRSLAQHPSALRFLADHGAVDTIFSLQGDSSLFV
                     ASAASQLLVHVLALSMRGGAEGQPCLPGGDWPACAQKIMDHVEESLCSAATPKVTQAL
                     NVLTTTFGRCQSPWTEALWVRLSPRVACLLERDPIPAAHSFVDLLLCVARSPVFSSSD
                     GSLWETVARALSCLGPTHMGPLALGILKLEHCPQALRTQAFQVLLQPLACVLKATVQA
                     PGPPGLLDGTADDATTVDTLLASKSSCAGLLCRTLAHLEELQPLPQRPSPWPQASLLG
                     ATVTVLRLCDGSAAPASSVGGHLCGTLAGCVRVQRAALDFLGTLSQGTGPQELVTQAL
                     AVLLECLESPGSSPTVLKKAFQATLRWLLSSPKTPGCSDLGPLIPQFLRELFPVLQKR
                     LCHPCWEVRDSALEFLTQLSRHWGGQADFRCALLASEVPQLALQLLQDPESYVRASAV
                     TAMGQLSSQGLHAPTSPEHAEARQSLFLELLHILSVDSEGFPRRAVMQVFTEWLRDGH
                     ADAAQDTEQFVATVLQAASRDLDWEVRAQGLELALVFLGQTLGPPRTHCPYAVALPEV
                     APAQPLTEALRALCHVGLFDFAFCALFDCDRPVAQKSCDLLLFLRDKIASYSSLREAR
                     GSPNTASAEATLPRWRAGEQAQPPGDQEPEAVLAMLRSLDLEGLRSTLAESSDHVEKS
                     PQSLLQDMLATGGFLQGDEADCY"
BASE COUNT          442 a          925 c          859 g          487 t
ORIGIN      
        1 gttgcggcgg aggacgcaac cgagcgggcc tgcggcctca ccatggaccc agaatgcgcc
       61 cagctgctcc cggctctctg tgctgttctg gtagatcccg ggcagccggt ggcagatgac
      121 acctgtttgg agaagctcct ggactggttt aaaacggtca ctgaaggaga gtccagtgtc
      181 gtgctgctgc aggagcaccc ctgcctggtg gagctgctgt cccatgtgct gaaagtccag
      241 gacctgagtt ctggggtcct ctccttctca ctgcgcctgg caggaacctt cgcagcccag
      301 gaaaactgct tccagtatct tcagcagggg gagttactac cagggctctt tggggagcca
      361 ggacccctcg gccgagcaac ctgggccgtc cccaccgtgc gcagcggctg gatccagggc
      421 ctgcgctccc tggcacagca ccccagcgcc ctgcgcttcc tggccgacca tggtgcggtc
      481 gacaccatct tctccctgca gggagactcc agcctgtttg tggcctcggc ggccagtcag
      541 ctcctggtgc acgtcctggc tttgtccatg cgaggtggag ccgaggggca gccctgcctg
      601 ccggggggtg actggcccgc gtgtgcccag aagatcatgg atcacgttga agagtccttg
      661 tgctccgcgg ccacccccaa ggtcactcag gccctgaacg tcctgaccac gaccttcggg
      721 cgctgccaga gcccctggac ggaagccctg tgggtgcggc tgagtccccg cgtggcctgt
      781 ctgctggaga gagaccccat ccccgccgca cactcgttcg tggacctgct tctctgtgtg
      841 gctcgttctc ccgtgttcag ttcttccgac ggcagcctgt gggagacagt ggcgcgggct
      901 ctgagctgcc tgggtcccac ccacatggga cccctggctt tggggatcct gaagctcgag
      961 cactgtccac aggcactgag gacccaggcc ttccaggtcc ttctccagcc cctggcctgt
     1021 gtcctgaagg ccacggttca ggcccccgga cccccaggct tgctggacgg gacggcagac
     1081 gatgccacga cggtggacac actcctggcc tccaagtcgt cctgcgccgg cctcctgtgc
     1141 cgcaccctgg ctcacctgga ggagctgcag ccgctgcccc agcgcccttc accgtggccc
     1201 caggcgtctc tactgggggc tacagtgact gtcctgcggc tctgtgacgg ctcggctgcc
     1261 cctgcctcca gtgtgggggg ccacctctgt gggaccctgg cgggctgcgt ccgggtccag
     1321 cgagcagccc tcgacttcct ggggacgctg tcacagggga caggccccca ggagctggtg
     1381 acgcaggcgc ttgctgtcct cctggagtgc ctcgagagcc ccggctccag ccccacggtt
     1441 ctgaagaagg ccttccaggc cacgctcagg tggctcctga gctcacccaa gacccccggc
     1501 tgctctgatc tcggccccct catcccgcag ttcctcagag agctgttccc tgtgctgcag
     1561 aaacgcctgt gccacccctg ctgggaggtg agggactccg ccctcgagtt cctgacccag
     1621 ctgagcaggc actggggagg acaggctgac ttcagatgcg cactcttggc ttcagaggtg
     1681 cctcagctgg ccctgcagct cctccaggac cctgagagtt atgtccgagc gagtgcagtg
     1741 accgccatgg ggcagctgtc cagccagggc ctgcacgccc ccaccagccc tgagcatgca
     1801 gaggcccggc agagcctgtt cctggagctc ctgcacatcc tctccgtaga ctcggagggc
     1861 ttcccacggc gggcggtcat gcaagtcttc actgagtggc tgcgggacgg ccacgccgac
     1921 gcggcccagg acacggagca gttcgtggcc actgtgctgc aggcggcgag ccgagacctg
     1981 gactgggagg tccgcgccca gggcctggag ctggccctcg tgttcctggg ccagactttg
     2041 gggccgccgc gtacccactg cccctatgcc gtggccctac ccgaggtggc cccagcccag
     2101 ccactcaccg aggcactgag ggctctctgc cacgtggggc tctttgactt cgccttttgt
     2161 gccttgtttg actgcgaccg ccctgtggcg cagaagtctt gtgacctcct tctcttcctg
     2221 agggacaaga ttgcttccta cagcagcctg cgggaggcca ggggcagccc caacactgcc
     2281 tccgcagagg ccaccctgcc gaggtggcgg gcgggtgagc aggcccagcc cccaggggac
     2341 caggagcctg aggctgtgct ggccatgctc aggtccctag acctggaggg cctgcggagc
     2401 acgctggccg agagcagcga ccacgtggaa aagagtcccc agtccctcct gcaggacatg
     2461 ctggccacgg gaggcttcct gcagggggac gaggccgact gctactgagc agaaccagag
     2521 tctgccactg gggctcagga ccaagggagg cagcaccatg tccttctgtg ggacactgcc
     2581 agccccaggg ctccagccca gcccggtgga tcctctgggg aagccaggac caggagagaa
     2641 gcaaggtcaa gaaatcccac agtttgatgt attaaagaaa tgacttattt ctactcaaaa
     2701 aaaaaaaaaa aaa
//