LOCUS       BC015027                1917 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens peptidase D, mRNA (cDNA clone MGC:9000 IMAGE:3920275),
            complete cds.
ACCESSION   BC015027
VERSION     BC015027.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1917)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1917)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-OCT-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 15 Row: l Column: 5
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 4557834.
FEATURES             Location/Qualifiers
     source          1..1917
                     /db_xref="H-InvDB:HIT000036969"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:9000 IMAGE:3920275"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_72"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1917
                     /gene="PEPD"
                     /gene_synonym="MGC10905"
                     /gene_synonym="PROLIDASE"
                     /db_xref="GeneID:5184"
                     /db_xref="HGNC:HGNC:8840"
                     /db_xref="MIM:170100"
     CDS             35..1516
                     /gene="PEPD"
                     /gene_synonym="MGC10905"
                     /gene_synonym="PROLIDASE"
                     /codon_start=1
                     /product="peptidase D"
                     /protein_id="AAH15027.1"
                     /db_xref="GI:15929143"
                     /db_xref="GeneID:5184"
                     /db_xref="HGNC:HGNC:8840"
                     /db_xref="MIM:170100"
                     /translation="MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGS
                     IVVLQGGEETQRYCTDTGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPA
                     SHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCRE
                     ASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMK
                     EYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFD
                     MGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLAD
                     RIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEP
                     GLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGGVR
                     IEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFSGPK"
BASE COUNT          408 a          547 c          548 g          414 t
ORIGIN      
        1 gccgcacttc acgtgacgcc ggtgccgggc gaacatggcg gcggccaccg gaccctcgtt
       61 ttggctgggg aatgaaaccc tgaaggtgcc gctggcgctc tttgccttga accggcagcg
      121 cctgtgtgag cggctgcgga agaaccctgc tgtgcaggcc ggctccatcg tggtcctgca
      181 gggcggggag gagactcagc gctactgcac cgacaccggg gtcctcttcc gccaggagtc
      241 cttctttcac tgggcgttcg gtgtcactga gccaggctgc tatggtgtca tcgatgttga
      301 cactgggaag tcgaccctgt ttgtgcccag gcttcctgcc agccatgcca cctggatggg
      361 aaagatccat tccaaggagc acttcaagga gaagtatgcc gtggacgacg tccagtacgt
      421 agatgagatt gccagcgtcc tgacgtcaca gaagccctct gtcctcctca ctttgcgtgg
      481 cgtcaacacg gacagcggca gtgtctgcag ggaggcctcc tttgacggca tcagcaagtt
      541 cgaagtcaac aataccattc ttcacccaga gatcgttgag tgccgagtgt ttaagacgga
      601 tatggagctg gaggttctgc gctataccaa taaaatctcc agcgaggccc accgtgaggt
      661 aatgaaggct gtaaaagtgg gaatgaaaga atatgagttg gaaagcctct tcgagcacta
      721 ctgctactcc cggggcggca tgcgccacag ctcctacacc tgcatctgcg gcagtggtga
      781 gaactcagcc gtgctacact acggacacgc cggagctccc aacgaccgaa cgatccagaa
      841 tggggatatg tgcctgttcg acatgggcgg tgagtattac tgcttcgctt ccgacatcac
      901 ctgctccttt cccgccaacg gcaagttcac tgcagaccag aaggccgtct atgaggcagt
      961 gctgcggagc tcccgtgccg tcatgggtgc catgaagcca ggtgtctggt ggcctgacat
     1021 gcaccgcctg gctgaccgca tccacctgga ggagctggcc cacatgggca tcctgagcgg
     1081 cagcgtggac gccatggtcc aggctcacct gggggccgtg tttatgcctc acgggcttgg
     1141 ccacttcctg ggcattgacg tgcacgacgt gggaggctac ccagagggcg tggagcgcat
     1201 cgacgagccc ggcctgcgga gcctgcgcac tgcacggcac ctgcagccag gcatggtgct
     1261 caccgtggag ccgggcatct acttcatcga ccacctcctg gatgaggccc tggcggaccc
     1321 ggcccgcgcc tccttcctta accgcgaggt cctgcagcgc tttcgcggtt ttggcggggt
     1381 ccgcatcgag gaggacgtcg tggtgactga cagcggcata gagctgctga cctgcgtgcc
     1441 ccgcactgtg gaagagattg aagcatgcat ggcaggctgt gacaaggcct ttaccccctt
     1501 ctctggcccc aagtagagcc agccagaaat cccagcgcac ctgggggcct ggccttgcaa
     1561 cctcttttcg tgatgggcag cctgctggtc agcactccag tagcgagaga cggcacccag
     1621 aatcagatcc cagcttcggc atttgatcag accaaacagt gctgtttccc ggggaggaaa
     1681 cactttttta attacccttt tgcaggctcc cacctttaat ctgttttata ccttgcttat
     1741 taaatgagcg acttaaaatg attgaaaata atgctgttct ttagtagcaa ctaaaatgtg
     1801 tcttgctgtc atttatattc cttttcccag gaaagaagca tttctgatac tttctgtcaa
     1861 aaatcaatat gcagaatggc atttgcaata aaaggtttcc taaaaaaaaa aaaaaaa
//