LOCUS       BC014966                3206 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens ribosomal protein S6 kinase, 90kDa, polypeptide 1,
            mRNA (cDNA clone MGC:23062 IMAGE:4867373), complete cds.
ACCESSION   BC014966
VERSION     BC014966.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3206)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3206)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-OCT-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 34 Row: k Column: 3.
FEATURES             Location/Qualifiers
     source          1..3206
                     /db_xref="H-InvDB:HIT000036928"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:23062 IMAGE:4867373"
                     /tissue_type="Colon, adenocarcinoma"
                     /clone_lib="NIH_MGC_15"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..3206
                     /gene="RPS6KA1"
                     /gene_synonym="HU-1"
                     /gene_synonym="MAPKAPK1A"
                     /gene_synonym="RSK"
                     /gene_synonym="RSK1"
                     /gene_synonym="S6K-alpha 1"
                     /db_xref="GeneID:6195"
                     /db_xref="HGNC:HGNC:10430"
                     /db_xref="MIM:601684"
     CDS             157..2364
                     /gene="RPS6KA1"
                     /gene_synonym="HU-1"
                     /gene_synonym="MAPKAPK1A"
                     /gene_synonym="RSK"
                     /gene_synonym="RSK1"
                     /gene_synonym="S6K-alpha 1"
                     /codon_start=1
                     /product="ribosomal protein S6 kinase, 90kDa, polypeptide
                     1"
                     /protein_id="AAH14966.1"
                     /db_xref="GI:15929013"
                     /db_xref="GeneID:6195"
                     /db_xref="HGNC:HGNC:10430"
                     /db_xref="MIM:601684"
                     /translation="MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEI
                     SITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLK
                     VRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFT
                     EEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKK
                     AYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILK
                     AKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREI
                     KPPFKPAVAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGK
                     PRAPQAPLHSVVQQLHGKNLVFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVKVID
                     KSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFS
                     EREASFVLHTIGKTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRA
                     ENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEE
                     ILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLP
                     QSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL"
BASE COUNT          716 a          909 c          937 g          644 t
ORIGIN      
        1 ctggtgactc gcggcggcgg cggcggacgg cccagccgga gcgcgagggg ctcggggggg
       61 cgcggcggtt cgggtcgcag agccagggac cccaggaccc gggaggcggc gcagccgggg
      121 ccgccggagg agcgcgggtg acctggcggc ggcgagatgc cgctcgccca gctcaaggag
      181 ccctggccgc tcatggagct agtgccgctg gacccggaga atggacagac ctcaggggaa
      241 gaagctggac ttcagccgtc caaggatgag ggcgtcctca aggagatctc catcacgcac
      301 cacgtcaagg ctggctctga gaaggctgat ccatcccatt tcgagctcct caaggttctg
      361 ggccagggat cctttggcaa agtcttcctg gtgcggaaag tcacccggcc tgacagtggg
      421 cacctgtatg ctatgaaggt gctgaagaag gcaacgctga aagtacgtga ccgcgtccgg
      481 accaagatgg agagagacat cctggctgat gtaaatcacc cattcgtggt gaagctgcac
      541 tatgccttcc agaccgaggg caagctctat ctcattctgg acttcctgcg tggtggggac
      601 ctcttcaccc ggctctcaaa agaggtgatg ttcacggagg aggatgtgaa gttttacctg
      661 gccgagctgg ctctgggcct ggatcacctg cacagcctgg gtatcattta cagagacctc
      721 aagcctgaga acatccttct ggatgaggag ggccacatca aactcactga ctttggcctg
      781 agcaaagagg ccattgacca cgagaagaag gcctattctt tctgcgggac agtggagtac
      841 atggcccctg aggtcgtcaa ccgccagggc cactcccata gtgcggactg gtggtcctat
      901 ggggtgttga tgtttgagat gctgacgggc tccctgccct tccaggggaa ggaccggaag
      961 gagaccatga cactgattct gaaggcgaag ctaggcatgc cccagtttct gagcactgaa
     1021 gcccagagcc tcttgcgggc cctgttcaag cggaatcctg ccaaccggct cggctccggc
     1081 cctgatgggg cagaggaaat caagcggcat gtcttctact ccaccattga ctggaataag
     1141 ctataccgtc gtgagatcaa gccacccttc aagccagcag tggctcagcc tgatgacacc
     1201 ttctactttg acaccgagtt cacgtcccgc acacccaagg attccccagg catccccccc
     1261 agcgctgggg cccatcagct gttccggggc ttcagcttcg tggccaccgg cctgatggaa
     1321 gacgacggca agcctcgtgc cccgcaggca cccctgcact cggtggtaca gcaactccat
     1381 gggaagaacc tggtttttag tgacggctac gtggtaaagg agacaattgg tgtgggctcc
     1441 tactctgagt gcaagcgctg tgtccacaag gccaccaaca tggagtatgc tgtcaaggtc
     1501 attgataaga gcaagcggga tccttcagaa gagattgaga ttcttctgcg gtatggccag
     1561 caccccaaca tcatcactct gaaagatgtg tatgatgatg gcaaacacgt gtacctggtg
     1621 acagagctga tgcggggtgg ggagctgctg gacaagatcc tgcggcagaa gttcttctca
     1681 gagcgggagg ccagctttgt cctgcacacc attggcaaaa ctgtggagta tctgcactca
     1741 cagggggttg tgcacaggga cctgaagccc agcaacatcc tgtatgtgga cgagtccggg
     1801 aatcccgagt gcctgcgcat ctgtgacttt ggttttgcca aacagctgcg ggctgagaat
     1861 gggctcctca tgacaccttg ctacacagcc aactttgtgg cgcctgaggt gctgaagcgc
     1921 cagggctacg atgaaggctg cgacatctgg agcctgggca ttctgctgta caccatgctg
     1981 gcaggatata ctccatttgc caacggtccc agtgacacac cagaggaaat cctaacccgg
     2041 atcggcagtg ggaagtttac cctcagtggg ggaaattgga acacagtttc agagacagcc
     2101 aaggacctgg tgtccaagat gctacacgtg gatccccacc agcgcctcac agctaagcag
     2161 gttctgcagc atccatgggt cacccagaaa gacaagcttc cccaaagcca gctgtcccac
     2221 caggacctac agcttgtgaa gggagccatg gctgccacgt actccgcact caacagctcc
     2281 aagcccaccc cccagctgaa gcccatcgag tcatccatcc tggcccagcg gcgagtgagg
     2341 aagttgccat ccaccaccct gtgaggcacc agggcattcg ggccacaggg cggtgctagc
     2401 ttgacagagt cagcatgctt cccagaggga gcaggccgga accacagggc cagagggagc
     2461 tggaacccga ggggccgggg aagctgccag cccagaacac ccctaatgag ggtgtgagaa
     2521 gtgccttctc cttccccagg atggactctt ctcggctcag gctctgctgg tggaaagcga
     2581 ttcactgtat aaactttttt ttatgaaaaa aatggcatca accaccatgg atttttacaa
     2641 gatccatttg cctttctggg agcagaaaca gccattgcgg ccccaggagg ggaactgagt
     2701 cacgctgggg ctctctgaga ctctttagag cagctttggg atcccaccct ggggaccccc
     2761 atgattggcc acctgtagcc atctgcacac acctccgaga cagtccagtg tcacctctct
     2821 cagagcatct ggctgtttag cagaactcat tctatcccca atcagctcct tttccgttct
     2881 gttctgctgg gagttctaga accacttcct gctacaggag gggtctcatg tcctgctggc
     2941 ttccagcttc aggcaccagc atccaccttg gctctgccag tggatcccct gcggtcaggc
     3001 tgggcagccc cagagagagg atgtggaaag cactttttgg ctgacttcat ctggggttgg
     3061 caacaggaca gagttcacag gaggccagtg ggcgggccat gagggacagg gtcttttttc
     3121 atttcttcct cagctggtta ctcagggttc atctgtccat ggcctttcta ataaactgtt
     3181 gagttgaaaa aaaaaaaaaa aaaaaa
//