LOCUS       BC014613                1586 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens syntaxin 18, mRNA (cDNA clone MGC:3333 IMAGE:2960768),
            complete cds.
ACCESSION   BC014613
VERSION     BC014613.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1586)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1586)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (24-SEP-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Oct 28, 2003 this sequence version replaced BC014613.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 10 Row: e Column: 15.
FEATURES             Location/Qualifiers
     source          1..1586
                     /db_xref="H-InvDB:HIT000036811"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:3333 IMAGE:2960768"
                     /tissue_type="Muscle, rhabdomyosarcoma"
                     /clone_lib="NIH_MGC_17"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1586
                     /gene="STX18"
                     /gene_synonym="Ufe1"
                     /db_xref="GeneID:53407"
                     /db_xref="HGNC:HGNC:15942"
                     /db_xref="MIM:606046"
     CDS             7..1014
                     /gene="STX18"
                     /gene_synonym="Ufe1"
                     /codon_start=1
                     /product="syntaxin 18"
                     /protein_id="AAH14613.1"
                     /db_xref="GeneID:53407"
                     /db_xref="HGNC:HGNC:15942"
                     /db_xref="MIM:606046"
                     /translation="MAVDITLLFRASVKTVKTRNKALGVAVGGGVDGSRDELFRRSPR
                     PKGDFSSRAREVISHIGKLRDFLLEHRKDYINAYSHTMSEYGRMTDTERDQIDQDAQI
                     FMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRV
                     VDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPATEERPEKILAETQPELGTW
                     GDGKGEDELSPEEIQMFEQENQRLIGEMNSLFDEVRQIEGRVVEISRLQEIFTEKVLQ
                     QEAEIDSIHQLVVGATENIKEGNEDIREAIKNNAGFRVWILFFLVMCSFSLLFLDWYD
                     S"
BASE COUNT          493 a          346 c          405 g          342 t
ORIGIN      
        1 gtcgctatgg cggtggacat cacgctgcta ttccgggcca gcgtcaagac cgtgaagacg
       61 cggaacaagg cgctgggagt ggcggtgggc ggcggggtcg atggcagccg ggacgagctg
      121 ttccgccgga gcccccggcc caagggcgac ttctccagcc gggcccgcga agtgatttct
      181 cacattggca aactgagaga ttttcttctg gaacacagga aagattatat taatgcttat
      241 agccatacca tgtctgaata tgggaggatg acagacacag aacgagacca gatagaccag
      301 gatgcccaga tattcatgag gacctgttca gaagcaattc agcaactacg aacagaagct
      361 cacaaggaga tacattccca gcaagtgaag gagcacagga ccgctgtttt ggatttcatt
      421 gaagattact tgaaaagagt atgtaaactt tactcagaac agagagccat ccgagttaaa
      481 agagtggtgg ataagaaaag attatctaag ttggaaccag aaccaaatac aaagacaaga
      541 gaatccacat cttctgagaa agtttcacag agtccttcaa aagactctga agaaaaccct
      601 gccactgaag aacgtccaga aaaaattttg gctgaaacac aacctgaatt gggaacgtgg
      661 ggagatggca aaggcgaaga tgagttatcc ccagaagaaa tacaaatgtt tgaacaggaa
      721 aatcagcgac taattggtga aatgaacagc ttgtttgatg aagtgaggca aatcgaaggg
      781 agagtggttg agatttccag actccaagag atattcacgg aaaaggtttt gcaacaggaa
      841 gctgagattg acagcattca ccagttagtt gtgggggcaa ctgaaaatat caaggaaggc
      901 aacgaagaca taagagaggc cattaaaaac aacgctggct tccgcgtgtg gatcctcttc
      961 ttcctcgtga tgtgctcctt ctccttgctc ttcctcgact ggtacgacag ctagccaggg
     1021 ccacgggggc ccagcacgag agtcctcatg ggcactcaca gactgcgtgc tttcatgtac
     1081 ttccagtgct ggagcatggt atgaccagat tttatcacag tgccatttga agggaaagga
     1141 gttcagacag acagacgtat tccccaaaaa gggatacccc aggccgatgg tgttcagcca
     1201 tttagcagct gaaaaaggaa acagtgcaca ccaatgggag gcagcctgcg tagccctcat
     1261 caggcaagac agactgaatg caggagtggg tgattagctg ctccttgaac ttgaggctgc
     1321 cttggcagca ggggcacagc aggcctcaag agcccctaat tgtctcaggg ttcaaaggaa
     1381 gacactgacc tttcccatcc cggtagcttc agggaagatc atagttaata acgtctctca
     1441 acaaatgatt acttctttgt ttccttgtgg cttcttgtct gtctgagtca acgaatacac
     1501 agacttactg gattatagaa gagaaaattc acatctgcct tgttaatcta ataaatataa
     1561 ttacagccaa aaaaaaaaaa aaaaaa
//