LOCUS       BC013781                2736 bp    mRNA    linear   HUM 03-OCT-2003
DEFINITION  Homo sapiens tubulin, gamma complex associated protein 3, mRNA
            (cDNA clone MGC:9866 IMAGE:3867019), complete cds.
ACCESSION   BC013781
VERSION     BC013781.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2736)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2736)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-SEP-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 13 Row: f Column: 14
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 5453659.
FEATURES             Location/Qualifiers
     source          1..2736
                     /db_xref="H-InvDB:HIT000036363"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:9866 IMAGE:3867019"
                     /tissue_type="Eye, retinoblastoma"
                     /clone_lib="NIH_MGC_67"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2736
                     /gene="TUBGCP3"
                     /gene_synonym="GCP3"
                     /gene_synonym="Spc98p"
                     /db_xref="GeneID:10426"
     CDS             146..2620
                     /gene="TUBGCP3"
                     /gene_synonym="GCP3"
                     /gene_synonym="Spc98p"
                     /codon_start=1
                     /product="TUBGCP3 protein"
                     /protein_id="AAH13781.1"
                     /db_xref="GeneID:10426"
                     /translation="MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFA
                     PTVERDEFLVAEKIKKELIRQRREADAALFSELHRKLHSQGVLKNKWSILYLLLSLSE
                     DPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLPLSYQDRSAQSAQSSGSVGSS
                     GISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTANQPSSQATT
                     SKGVPSAVSRNMTRSRREGDTGGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYK
                     VEGKANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELRE
                     YYRLLSVLHSQLQLEDDQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRK
                     GGELASAVHAYTKTGDPYMRSLVQHILSLVSHPVLSFLYRWIYDGELEDTYHEFFVAS
                     DPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSINFLHQVCHDQTPTTKMIA
                     VTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQAMRRYL
                     LLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVR
                     LLEVSPGDTGWDVFSLDYHVDGPIATVFTRECMSHYLRVFNFLWRAKRMEYILTDIRK
                     GHMCNAKLLRNMPEFSGVLHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQ
                     AQDLDHIIAAHEVFLDTIISRCLLDSDSRALLNQLRAVFDQIIELQNAQDAIYRAALE
                     ELQRRLQFEEKKKQREIEVEMCLYCV"
     misc_feature    893..2350
                     /gene="TUBGCP3"
                     /gene_synonym="GCP3"
                     /gene_synonym="Spc98p"
                     /note="Spc97_Spc98; Region: Spc97 / Spc98 family. The
                     spindle pole body (SPB) functions as the
                     microtubule-organising centre in yeast. Members of this
                     family are spindle pole body (SBP) components such as
                     Spc97 and Spc98 that form a complex with gamma-tubulin"
                     /db_xref="CDD:pfam04130"
BASE COUNT          745 a          658 c          696 g          637 t
ORIGIN      
        1 cgccctggtg gccggcggcg cccgcgcctt agcctgtcag gagcagggag cttgcggggc
       61 gcaggaaggg cgcgggccgc ggtccctgcg cgtgcggcgg cagtggcggc tctgcccgga
      121 ccaccgtgca cggctccggg cgaggatggc gaccccggac cagaagtcgc cgaacgttct
      181 gctgcagaac ctgtgctgca ggatcctggg caggagcgaa gctgatgtag cccagcagtt
      241 ccagtatgct gtgcgggtga ttggcagcaa cttcgcccca actgttgaaa gagatgaatt
      301 tttagtagct gaaaaaatca agaaagagct tattcgacaa cgaagagaag cagatgctgc
      361 attattttca gaactccaca gaaaacttca ttcacaggga gttttgaaaa ataaatggtc
      421 aatactctac ctcttgctga gcctcagtga ggacccacgc aggcagccaa gcaaggtttc
      481 tagctatgct acgttatttg ctcaggcctt accaagagat gcccactcaa ccccttacta
      541 ctatgccagg cctcagaccc ttcccctgag ctaccaagat cggagtgccc agtcagccca
      601 gagctccggc agcgtgggca gcagtggcat cagcagcatt ggcctgtgtg ccctcagtgg
      661 ccccgcgcct gcgccacaat ctctcctccc aggacagtct aatcaagctc caggagtagg
      721 agattgcctt cgacagcagt tggggtcacg actcgcatgg actttaactg caaatcagcc
      781 ttcttcacaa gccactacct caaaaggtgt ccccagtgct gtgtctcgca acatgacaag
      841 gtccaggaga gaaggggata cgggtggtac tatggaaatt acagaagcag ctctggtaag
      901 ggacattttg tacgtctttc agggcataga tggcaaaaac atcaaaatga acaacactga
      961 aaattgttac aaagtagaag gaaaggcaaa tctaagtagg tctttgagag acacagcagt
     1021 caggctttct gagttgggat ggttgcataa taaaatcaga agatacacgg accagaggag
     1081 cctggaccgc tcattcggac tcgtcgggca gagcttttgt gctgccttgc accaggaact
     1141 cagagaatac tatcgattgc tctctgtttt acattctcag ctacaactag aggatgacca
     1201 gggtgtgaat ttgggacttg agagtagttt aacacttcgg cgcctcctgg tttggaccta
     1261 tgatcccaaa atacgactga agacccttgc ggccctagtg gaccactgcc aaggaaggaa
     1321 aggaggtgag ctggcctcag ctgtccacgc ctacacaaaa acaggagacc cgtacatgcg
     1381 gtctctggtg cagcacatcc tcagcctcgt gtctcatcct gttttgagct tcctgtaccg
     1441 ctggatatat gatggggagc ttgaggacac ttaccacgaa ttttttgtag catcagatcc
     1501 aacagttaaa acagatcgac tgtggcacga caagtatact ttgaggaaat cgatgattcc
     1561 ttcgtttatg acgatggatc agtctaggaa ggtccttttg ataggaaaat caataaattt
     1621 cttgcaccaa gtttgtcatg atcagactcc cactacaaag atgatagctg tgaccaagtc
     1681 tgcagagtca ccccaggacg ctgcagacct attcacagac ttggaaaatg catttcaggg
     1741 gaagattgat gctgcttatt ttgagaccag caaatacctg ttggatgttc tcaataaaaa
     1801 gtacagcttg ctggaccaca tgcaggcaat gaggcggtac ctgcttcttg gtcaaggaga
     1861 ctttataagg cacttaatgg acttgctaaa accagaactt gtccgtccag ctacgacttt
     1921 gtatcagcat aacttgactg gaattctaga aaccgctgtc agagccacca acgcacagtt
     1981 tgacagtcct gagatcctgc gaaggctgga cgtgcggctg ctggaggtct ctccaggtga
     2041 cactggatgg gatgtcttca gcctcgatta tcatgttgac ggaccaattg caactgtgtt
     2101 tactcgagaa tgtatgagcc actacctaag agtatttaac ttcctctgga gggcgaagcg
     2161 gatggaatac atcctcactg acatacggaa gggacacatg tgcaatgcaa agctcctgag
     2221 aaacatgcca gagttctccg gggtgctgca ccagtgtcac attttggcct ctgagatggt
     2281 ccatttcatt catcagatgc agtattacat cacatttgag gtgcttgaat gttcttggga
     2341 tgagctttgg aacaaagtcc agcaggccca ggatttggat cacatcattg ctgcacacga
     2401 ggtgttctta gacaccatca tctcccgctg cctgctggac agtgactcca gggcactttt
     2461 aaatcaactt agagctgtgt ttgatcaaat tattgaactt cagaatgctc aagatgcaat
     2521 atacagagct gctctggaag aattgcagag acgattacag tttgaagaga aaaagaaaca
     2581 gcgtgaaatt gaggttgaga tgtgcctata ctgcgtttga agtcccgaga aatcactgac
     2641 agttgtaaag agggaggggc caccctcact ggcatcatca tcctgtttca caaaataaat
     2701 aaaaacagca gcattcatga gaaaaaaaaa aaaaaa
//