LOCUS       BC013152                1469 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transmembrane protein 5, mRNA (cDNA clone MGC:17085
            IMAGE:3919181), complete cds.
ACCESSION   BC013152
VERSION     BC013152.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1469)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1469)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 26 Row: c Column: 9
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 7657177.
FEATURES             Location/Qualifiers
     source          1..1469
                     /db_xref="H-InvDB:HIT000036152"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:17085 IMAGE:3919181"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_72"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1469
                     /gene="TMEM5"
                     /gene_synonym="HP10481"
                     /db_xref="GeneID:10329"
                     /db_xref="HGNC:HGNC:13530"
                     /db_xref="MIM:605862"
     CDS             91..1422
                     /gene="TMEM5"
                     /gene_synonym="HP10481"
                     /codon_start=1
                     /product="transmembrane protein 5"
                     /protein_id="AAH13152.1"
                     /db_xref="GeneID:10329"
                     /db_xref="HGNC:HGNC:13530"
                     /db_xref="MIM:605862"
                     /translation="MRLTRKRLCSFLIALYCLFSLYAAYHVFFGRRRQAPAGSPRGLR
                     KGAAPARERRGREQSTLESEEWNPWEGDEKNEQQHRFKTSLQILDKSTKGKTDLSVQI
                     WGKAAIGLYLWEHIFEGLLDPSDVTAQWREGKSIVGRTQYSFITGPAVIPGYFSVDVN
                     NVVLILNGREKAKIFYATQWLLYAQNLVQIQKLQHLAVVLLGNEHCDNEWINPFLKRN
                     GGFVELLFIIYDSPWINDVDVFQWPLGVATYRNFPVVEASWSMLHDERPYLCNFLGTI
                     YENSSRQALMNILKKDGNDKLCWVSAREHWQPQETNESLKNYQDALLQSDLTLCPVGV
                     NTECYRIYEACSYGSIPVVEDVMTAGNCGNTSVHHGAPLQLLKSMGAPFIFIKNWKEL
                     PAVLEKEKTIILQEKIERRKMLLQWYQHFKTELKMKFTNILESSFLMNNKS"
BASE COUNT          446 a          300 c          349 g          374 t
ORIGIN      
        1 ggctgggcct gcctcggacg ccgccggtgt cgcggattct ctttccgccc gctccatggc
       61 ggtggatgcc tgactggaag cccgagtggg atgcggctga cgcggaagcg gctctgctcg
      121 tttcttatcg ccctgtactg cctattctcc ctctacgctg cctaccacgt cttcttcggg
      181 cgccgccgcc aggcgccggc cgggtccccg cggggcctca ggaagggggc ggcccccgcg
      241 cgggagagac gcggccgaga acagtccact ttggaaagtg aagaatggaa tccttgggaa
      301 ggagatgaaa aaaatgagca acaacacaga tttaaaacta gccttcaaat attagataaa
      361 tccacgaaag gaaaaacaga tctcagtgta caaatctggg gcaaagctgc cattggcttg
      421 tatctctggg agcatatttt tgaaggctta cttgatccca gcgatgtgac tgctcaatgg
      481 agagaaggaa agtcaatcgt aggaagaaca cagtacagct tcatcactgg tccagctgta
      541 ataccagggt acttctccgt tgatgtgaat aatgtggtac tcattttaaa tggaagagaa
      601 aaagcaaaga tcttttatgc cacccagtgg ttactttatg cacaaaattt agtgcaaatt
      661 caaaaactcc agcatcttgc tgttgttttg ctcggaaatg aacattgtga taatgagtgg
      721 ataaacccat tcctcaaaag aaatggaggc ttcgtggagc tgcttttcat aatatatgac
      781 agcccctgga ttaatgacgt ggatgttttt cagtggcctt taggagtagc aacatacagg
      841 aattttcctg tggtggaggc aagttggtca atgctgcatg atgagaggcc atatttatgt
      901 aatttcttag gaacgattta tgaaaattca tccagacagg cactaatgaa cattttgaaa
      961 aaagatggga acgataagct ttgttgggtt tcagcaagag aacactggca gcctcaggaa
     1021 acaaatgaaa gtcttaagaa ttaccaagat gccttgcttc agagtgatct cacattgtgc
     1081 ccggtcggag taaacacaga atgctatcga atctatgagg cttgctccta tggctccatt
     1141 cctgtggtgg aagacgtgat gacagctggc aactgtggga atacatctgt gcaccacggt
     1201 gctcctctgc agttactcaa gtccatgggt gctcccttta tctttatcaa gaactggaag
     1261 gaactccctg ctgttttaga aaaagagaaa actataattt tacaagaaaa aattgaaaga
     1321 agaaaaatgt tacttcagtg gtatcagcac ttcaagacag agcttaaaat gaaatttact
     1381 aatattttag aaagctcatt tttaatgaat aataaaagtt aattatcttt ttgagctaaa
     1441 aaaaaaaaaa aaaaaaaaaa aaaaaaaaa
//