LOCUS       BC012152                3259 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens tripartite motif-containing 62, mRNA (cDNA clone
            MGC:20370 IMAGE:4558639), complete cds.
ACCESSION   BC012152
VERSION     BC012152.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3259)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3259)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 29 Row: d Column: 2.
FEATURES             Location/Qualifiers
     source          1..3259
                     /db_xref="H-InvDB:HIT000035695"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:20370 IMAGE:4558639"
                     /tissue_type="Eye, retinoblastoma"
                     /clone_lib="NIH_MGC_16"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..3259
                     /gene="TRIM62"
                     /gene_synonym="FLJ10759"
                     /db_xref="GeneID:55223"
                     /db_xref="HGNC:HGNC:25574"
     CDS             34..1461
                     /gene="TRIM62"
                     /gene_synonym="FLJ10759"
                     /codon_start=1
                     /product="tripartite motif-containing 62"
                     /protein_id="AAH12152.1"
                     /db_xref="GeneID:55223"
                     /db_xref="HGNC:HGNC:25574"
                     /translation="MACSLKDELLCSICLSIYQDPVSLGCEHYFCRRCITEHWVRQEA
                     QGARDCPECRRTFAEPALAPSLKLANIVERYSSFPLDAILNARRAARPCQAHDKVKLF
                     CLTDRALLCFFCDEPALHEQHQVTGIDDAFDELQRELKDQLQALQDSEREHTEALQLL
                     KRQLAETKSSTKSLRTTIGEAFERLHRLLRERQKAMLEELEADTARTLTDIEQKVQRY
                     SQQLRKVQEGAQILQERLAETDRHTFLAGVASLSERLKGKIHETNLTYEDFPTSKYTG
                     PLQYTIWKSLFQDIHPVPAALTLDPGTAHQRLILSDDCTIVAYGNLHPQPLQDSPKRF
                     DVEVSVLGSEAFSSGVHYWEVVVAEKTQWVIGLAHEAASRKGSIQIQPSRGFYCIVMH
                     DGNQYSACTEPWTRLNVRDKLDKVGVFLDYDQGLLIFYNADDMSWLYTFREKFPGKLC
                     SYFSPGQSHANGKNVQPLRINTVRI"
BASE COUNT          738 a         1021 c          858 g          642 t
ORIGIN      
        1 cctcgggccc ccctctctgc tgcccctggc gccatggcgt gcagcctcaa ggacgagctg
       61 ctgtgctcca tctgcctgag catctaccag gacccggtga gcctgggctg cgagcactac
      121 ttctgccgcc gctgcatcac ggagcactgg gtgcggcagg aggcgcaggg cgcccgcgac
      181 tgccccgagt gccggcgcac gttcgccgag cccgcgctgg cgcccagcct caagctggcc
      241 aacatcgtgg agcgctacag ctccttcccg ctggacgcca tcctcaacgc gcgccgcgcc
      301 gcgcgaccct gccaggcgca cgacaaggtc aagctcttct gcctcacgga ccgcgcgctt
      361 ctctgcttct tctgcgacga gcctgcactg cacgagcagc atcaggtcac cggcatcgac
      421 gacgccttcg acgagctgca gagggagctg aaggaccaac ttcaggccct tcaagacagc
      481 gagcgggaac acaccgaagc gctgcagctg ctcaagcgac aactggcgga gaccaagtct
      541 tccaccaaga gcctgcggac cactatcggc gaggccttcg agcggctgca ccggctgctg
      601 cgtgaacgcc agaaggccat gctagaggag ctggaggcgg acacggcccg cacgctgacc
      661 gacatcgagc agaaagtcca gcgctacagc cagcagctgc gcaaggtcca ggagggagcc
      721 cagatcctgc aggagcggct ggctgaaacc gaccggcaca ccttcctggc tggggtggcc
      781 tcactgtccg agcggctcaa gggaaaaatc catgagacca acctcacata tgaagacttc
      841 ccgacctcca agtacacagg ccccctgcag tacaccatct ggaagtccct gttccaggac
      901 atccacccag tgccagccgc cctaaccctg gacccgggca cagcccacca gcgcctgatc
      961 ctgtcggacg actgcaccat tgtggcttac ggcaacttgc acccacagcc actgcaggac
     1021 tcgccaaagc gcttcgatgt ggaggtgtcg gtgctgggtt ctgaagcctt cagtagtggc
     1081 gtccactact gggaggtggt ggtggcggag aagacccagt gggtgatcgg gctggcacac
     1141 gaagccgcaa gccgcaaggg cagcatccag atccagccca gccgcggctt ctactgcatc
     1201 gtgatgcacg atggcaacca gtacagcgcc tgcacggagc cctggacgcg gcttaacgtc
     1261 cgggacaagc ttgacaaggt gggtgtcttc ctggactatg accaaggctt gctcatcttc
     1321 tacaatgctg atgacatgtc ctggctctac accttccgcg agaagttccc tggcaagctc
     1381 tgctcttact tcagccctgg ccagagccac gccaatggca agaacgttca gccgctgcgg
     1441 atcaacaccg tccgcatcta gtccaggcag aaggagacca caacctcctg ggaccactgc
     1501 cacctgcaag agccctgccc aggagataga agacctggac tccagcccac cgtggccact
     1561 ggagacctca ggccagttgt ttaccctcca gcctccagtc tgtaaaatgg aggttgcatt
     1621 ccctacttcc taaactctct tccagcatcg atgttctgta gctctgacct tgatagggat
     1681 acagctttga tccaaggatg tgacatggct tctcctcagg gcaacccctg cccaaccctc
     1741 atccccatct tctcaggggc aggggactac cttccagtgt ctccctccag cccagccctg
     1801 acctcaggaa gtgtcagagc atggccagta gttggcagcc cgaaagacac acagcacctc
     1861 ttatgtccca tggcctaaga cttacccctg accaagctag tgatgggcca tttacccttg
     1921 accccagtcc acagtggtca caggtagtac ctggtcctag ggttgcctga gagccaacct
     1981 ctcctgccac ccccacacca agaactatat ggttcctact tctcccactg atctgctggt
     2041 cagtgatgat gctgtggcct gtggaaggca cctggtagtt gagtccacac attatagtca
     2101 tgtgccacca ccttcctgcc cacaggccga gggacagggt gagggtatac ccaaagctga
     2161 tgcagagccc attagcctaa aagcaactgc aggacaagcc tccctggatg atcgaggtcc
     2221 ccagtagctc tgaacaagag tccagccaac cctcttcagc caggcctctg tgacctgcta
     2281 gggtgcagga ggcttccaga agcagttgtt gtaattagga cccaagcact gggaggggct
     2341 gttggctaga ccccttgtca gacttggcat ctatctcagt taggatcctg ctgcagaaaa
     2401 caagagccac ttgtagctgg tttaattaga caaggattta ctacctggcc cctggtggct
     2461 tgcaaaattg ttggaagagc tggagaagca gactctgctg aatttccagg aactcccagc
     2521 gccagattca tcatgtctgt tgtgaccagg aaagctgccc ccatctgcag gaagccacta
     2581 tgccagaaag ctgctgactg cagaactagg ctccctctgc cacggtccgt gccagccaat
     2641 agatgtcctg aggcctgccc ctctcccact tcactcagtt cccaaatcta aatttttaca
     2701 agagattctg tttgggggaa cttaagtcag atccagaacc ttggctgcaa gggagtctgg
     2761 gaaatgtcat ttccctagaa ggaagttagg gtgggtggag caagccccac ctgcgttttt
     2821 ctgccacagc atccaatcgt gaagaactcg ggagagggtg gagtccacat ctagggttgt
     2881 cctgcccctt ggctctatcc ctgcccagag gtgggaactg gaggagtggg ctgcaagact
     2941 gagcctaaat gtctccccgg ccttgacttt tctttctagt cctggggcct agattctgca
     3001 cttggggtct ctgacacaac acaccatccc aaagtagccg gaagagctaa acacaggggg
     3061 ttcttaaaat ggctgccccc gccacccggg cctcccttgg gcaaaaggaa ttgtcagccc
     3121 taccccaacc cttcaactac cagaatctgg gccaccccag cagtattttt atttaaaatg
     3181 ttgcccattt tatgagttat gatcaatttg tattaaatta aagttacaga tgtcaaaaaa
     3241 aaaaaaaaaa aaaaaaaaa
//