LOCUS       BC011948                2142 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transmembrane protein 115, mRNA (cDNA clone MGC:18285
            IMAGE:4178931), complete cds.
ACCESSION   BC011948
VERSION     BC011948.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2142)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2142)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUL-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: David N. Louis, M.D.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 12 Row: i Column: 10
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis.
FEATURES             Location/Qualifiers
     source          1..2142
                     /db_xref="H-InvDB:HIT000035558"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:18285 IMAGE:4178931"
                     /tissue_type="Brain, anaplastic oligodendroglioma with
                     1p/19q loss"
                     /clone_lib="NCI_CGAP_Brn67"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2142
                     /gene="TMEM115"
                     /gene_synonym="PL6"
                     /db_xref="GeneID:11070"
                     /db_xref="HGNC:HGNC:30055"
                     /db_xref="MIM:607069"
     CDS             410..1465
                     /gene="TMEM115"
                     /gene_synonym="PL6"
                     /codon_start=1
                     /product="transmembrane protein 115"
                     /protein_id="AAH11948.1"
                     /db_xref="GeneID:11070"
                     /db_xref="HGNC:HGNC:30055"
                     /db_xref="MIM:607069"
                     /translation="MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGC
                     LAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFF
                     SVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLR
                     VPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDM
                     ADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTD
                     PQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKG
                     AAPESSLITFEAAPPTL"
BASE COUNT          457 a          671 c          619 g          395 t
ORIGIN      
        1 gccaggccga gcgggagctg accaggcttg actcgggtac agaacgaggc accagtcccc
       61 ttgcgaaccg aagggcctcg cagtggatgg aggaggccca gccctgaggt caacgccaac
      121 caggctagcc tggcacgggg cctacagggt gggtaggcgg gcgtgccgca gccgtccagg
      181 gccttccctc aggtcccggg cgaggggcct acgctgcggc ccggcaacaa ggcccgactc
      241 ggcccctcgg gaccagagcc ccacccgatc ggaagcggat cctttaccag ggccataggc
      301 cagtgactag gccgggcctg ggcctcccat cggggccgga ctaggacgag gccccgggga
      361 ggcccctggc ctaccagacc cttttctcag gccgacagcc gccaggaaga tgcaacgtgc
      421 cctgccaggc gcccgccagc acttgggggc cattctggcc agcgccagcg tggtggtgaa
      481 ggctctgtgt gcggcggtac tattcctcta cctgctctcc ttcgccgtgg acacaggctg
      541 cctggcggtc accccgggct acctctttcc tcccaacttc tggatctgga ccctggccac
      601 ccatgggctg atggagcagc atgtgtggga cgtggccatc agcctgacaa cggtggtggt
      661 ggccgggcgt ttgctggagc ccctctgggg ggccttggag ctgctcatct tcttctcagt
      721 ggtgaatgtg tctgtagggc tgctgggggc cttcgcctac ctcctcacct acatggcttc
      781 cttcaacctg gtctacctgt tcactgtccg tatccacggc gccttgggct tcctaggtgg
      841 cgtcctggtg gcactcaagc aaaccatggg ggactgtgtg gtcctgcgag tgccccaggt
      901 gcgcgtcagt gtgatgccca tgctgctgct ggcgctgctg ctcctgctgc ggctcgccac
      961 gctgctccag agcccggcgc tggcttccta tggcttcggg ctgctctcca gttgggtata
     1021 tcttcgcttc taccagcgcc atagccgggg ccgaggggac atggctgacc actttgcttt
     1081 cgccactttc ttccctgaga tcctgcagcc tgtggtgggt ttgctggcga acttggtgca
     1141 cagcctcctg gtgaaggtaa agatatgcca gaagacggtg aagcgctacg atgtgggtgc
     1201 cccatcctcc atcaccatca gcctgccagg cacagaccct caagacgccg agcggagaag
     1261 gcaactggcc ctgaaggcac tcaatgagcg gctgaagaga gtggaagacc agtccatctg
     1321 gcccagcatg gatgatgatg aagaggagtc tggggccaag gtggacagcc ccctgccctc
     1381 agacaaagct cccacacccc cagggaaggg ggctgcccca gaatccagtc taatcacctt
     1441 cgaggcagct cccccgacgc tgtaactcca gaccaccttg agtgtggcac ctcccctccc
     1501 aagcccccct tgacatcctc tcagctactc cagggcacct gactgctctg aggagaggga
     1561 agaaggcctg ctggggcttt ccatggcctt ctgctgtttc tcgccaacac tacccaggac
     1621 tcttgctacc tggttccaac tccagacaac cactatgcca ggcccggagc ctctgaggca
     1681 tcggccagtc caggccctca tctgaggtaa gaatgtacat cagctggcag ccccaagcaa
     1741 gtggctgcag ggacactgat gccacagctc ctgggccggc cctcacatct gaaactggtt
     1801 gccgagagcc ctgagccaag gcaaggattt gccaaaaatg ttctgggggc ccagcaaatg
     1861 caggagccga cctggggctg cacatccctg cccatcccca gaaagactgt tcctgtcagg
     1921 atttgtttcc ctctgctgtg gcggtgactg cttctggacc agaacagctc cagctcccag
     1981 gtattttcta caggaccact tgagtgggca gccaagccca ggctcgcagt atcaataaag
     2041 cagttctctg aggaatgaca aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     2101 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa
//