LOCUS       BC011884                2260 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transcription factor 25 (basic helix-loop-helix), mRNA
            (cDNA clone MGC:19865 IMAGE:3678670), complete cds.
ACCESSION   BC011884
VERSION     BC011884.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2260)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2260)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUL-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC011884.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: Louis M. Staudt, M.D., Ph.D.
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 28 Row: e Column: 4
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 14149656.
FEATURES             Location/Qualifiers
     source          1..2260
                     /db_xref="H-InvDB:HIT000035513"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:19865 IMAGE:3678670"
                     /tissue_type="Lymph, Burkitt lymphoma"
                     /clone_lib="NIH_MGC_8"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2260
                     /gene="TCF25"
                     /gene_synonym="FKSG26"
                     /gene_synonym="hKIAA1049"
                     /gene_synonym="Hulp1"
                     /gene_synonym="KIAA1049"
                     /gene_synonym="NULP1"
                     /gene_synonym="PRO2620"
                     /db_xref="GeneID:22980"
                     /db_xref="HGNC:HGNC:29181"
     CDS             57..2087
                     /gene="TCF25"
                     /gene_synonym="FKSG26"
                     /gene_synonym="hKIAA1049"
                     /gene_synonym="Hulp1"
                     /gene_synonym="KIAA1049"
                     /gene_synonym="NULP1"
                     /gene_synonym="PRO2620"
                     /codon_start=1
                     /product="transcription factor 25 (basic
                     helix-loop-helix)"
                     /protein_id="AAH11884.1"
                     /db_xref="GeneID:22980"
                     /db_xref="HGNC:HGNC:29181"
                     /translation="MSRRALRRLRGEQRGQEPLGPGALHFDLRDDDDAEEEGPKRELG
                     VRRPGGAGKEGVRVNNRFELINIDDLEDDPVVNGERSGCALTDAVAPGNKGRGQRGNT
                     ESKTDGDDTETVPSEQSHASGKLRKKKKKQKNKKSSTGEASENGLEDIDRILERIEDS
                     TGLNRPGPAPLSSRKHVLYVEHRHLNPDTELKRYFGARAILGEQRPRQRQRVYPKCTW
                     LTTPKSTWPRYSKPGLSMRLLESKKGLSFFAFEHSEEYQQAQHKFLVAVESMEPNNIV
                     VLLQTSPYHVDSLLQLSDACRFQEDQEMARDLVERALYSMECAFHPLFSLTSGACRLD
                     YRRPENRSFYLALYKQMSFLEKRGCPRTALEYCKLILSLEPDEDPLCMLLLIDHLALR
                     ARNYEYLIRLFQEWEAHRNLSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLL
                     IQQALTMFPGVLLPLLESCSVRPDASVSSHRFFGPNAEISQPPALSQLVNLYLGRSHF
                     LWKEPATMSWLEENVHEVLQAVDAGDPAVEACENRRKVLYQRAPRNIHRHVILSEIKE
                     AVAALPPDVTTQSVMGFDPLPPSDTIYSYVRPERLSPISHGNTIALFFRSLLPNYTME
                     GERPEEGVAGGLNRNQGLNRLMLAVRDMMANFHLNDLEAPHEDDAEGEGEWD"
BASE COUNT          521 a          652 c          665 g          422 t
ORIGIN      
        1 ccgagttttc tgcgcttcct tctccctctc tccagacgtc gtggtcgttc ggtcctatgt
       61 cgcgccgggc cctccggagg ctgagggggg aacagcgcgg ccaggagccc ctcgggcccg
      121 gcgccttgca tttcgatctc cgtgatgacg atgacgcgga agaagaaggg cccaagcggg
      181 agcttggtgt ccggcgtccc gggggcgcag ggaaggaggg cgtccgagtc aacaaccgct
      241 tcgagctgat aaacattgac gatcttgagg atgaccctgt ggtgaacggg gagaggtctg
      301 gctgtgcgct cacagacgct gtggcaccag ggaacaaagg aaggggtcag cgtggaaaca
      361 cagagagcaa gacggatgga gatgacaccg agacagtgcc ctcagagcag tctcatgcaa
      421 gtggcaaact ccggaagaag aaaaaaaaac agaaaaacaa gaaaagcagc acgggagaag
      481 catcggaaaa cggactagaa gatatcgatc gcatcctaga gaggattgag gacagcactg
      541 ggttgaaccg tcccggccca gctcccctga gctccaggaa gcacgttctc tacgtggagc
      601 acagacactt gaatccagac acagaactga aaaggtattt tggtgcccgg gcaatcctgg
      661 gggagcaaag gccacggcag agacaacgtg tgtaccccaa gtgcacatgg ctgaccaccc
      721 ctaaaagcac ctggccccgc tacagcaaac caggtctgtc catgcggctg ctggaatcaa
      781 aaaaaggcct ctccttcttt gcgtttgagc acagtgagga gtaccagcag gctcagcaca
      841 agttcctggt ggccgtggag tctatggagc cgaacaacat cgtggttctg ctccagacga
      901 gcccttacca cgttgactca ctcctgcagc tcagcgatgc ctgccgcttt caagaggatc
      961 aggagatggc tcgagacctc gtagagagag cgctgtacag catggaatgt gcgttccacc
     1021 ccctgttcag tctcaccagt ggggcctgcc ggctggatta ccgcagaccc gagaacagga
     1081 gcttctacct ggccctctac aagcagatga gcttcctgga gaagcgaggc tgcccgcgca
     1141 cggcgctgga gtactgcaag ctcatcctga gtctcgagcc ggatgaggac cccctctgca
     1201 tgctgctgct catcgaccac ctggccttgc gggcccggaa ctacgagtac ctgatccgcc
     1261 tcttccagga gtgggaggct catcggaacc tgtcccagct ccctaatttt gccttctctg
     1321 ttccactggc gtatttcctg ctgagccagc agacagacct ccctgagtgt gagcagagct
     1381 ctgccaggca gaaggcctct ctcctgatac agcaggcgct caccatgttc cctggagtcc
     1441 tcctgcccct gctcgagtct tgcagtgtgc ggcccgacgc cagcgtttcc agtcaccgct
     1501 tctttggacc caatgctgaa ataagccagc cccctgccct gagccagctg gtgaacctgt
     1561 accttgggag gtcacacttt ctctggaaag agcccgccac catgagctgg ctggaggaga
     1621 acgtccacga ggttctgcaa gcagtggacg ccggggaccc agccgtggaa gcctgtgaga
     1681 accggcggaa ggtgctctac cagcgtgcac ccaggaatat ccaccgccat gtgatcctct
     1741 ctgagatcaa ggaagccgtc gctgccctgc ccccggacgt gaccacgcag tctgtgatgg
     1801 ggtttgatcc tctgcctcct tcggacacaa tctactccta cgtcaggcca gagaggctaa
     1861 gtcctatcag ccatggaaac accattgctc tcttcttccg gtcactgttg ccaaactata
     1921 ccatggaggg ggagaggccc gaggaaggag tggctggggg tctgaaccgc aaccagggcc
     1981 tgaacaggct gatgctggct gtgcgcgaca tgatggccaa cttccacctc aacgacctgg
     2041 aggcgccgca cgaggacgac gctgaggggg agggggagtg ggactgagcg tccgcagagg
     2101 tgaccgaaaa gccgtatgat gatgttcccg atttctctgt tggtcggagt cggccagttg
     2161 cctgaagtag ggaagctgag tgtgtcgctc cctggtccac tgtttctcct ataaatgtaa
     2221 atgggtcacg ctcaaaaaaa aaaaaaaaaa aaaaaaaaaa
//