LOCUS       BC011713                2042 bp    mRNA    linear   HUM 02-DEC-2006
DEFINITION  Homo sapiens tRNA methyltransferase 12 homolog (S. cerevisiae),
            mRNA (cDNA clone MGC:19516 IMAGE:3929724), complete cds.
ACCESSION   BC011713
VERSION     BC011713.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2042)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2042)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUL-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC011713.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 27 Row: j Column: 17
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 8923675.
FEATURES             Location/Qualifiers
     source          1..2042
                     /db_xref="H-InvDB:HIT000035396"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:19516 IMAGE:3929724"
                     /tissue_type="Ovary, adenocarcinoma"
                     /clone_lib="NIH_MGC_9"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2042
                     /gene="TRMT12"
                     /gene_synonym="FLJ20772"
                     /gene_synonym="TRM12"
                     /gene_synonym="TYW2"
                     /db_xref="GeneID:55039"
                     /db_xref="HGNC:HGNC:26091"
     CDS             97..1443
                     /gene="TRMT12"
                     /gene_synonym="FLJ20772"
                     /gene_synonym="TRM12"
                     /gene_synonym="TYW2"
                     /codon_start=1
                     /product="tRNA methyltransferase 12 homolog (S.
                     cerevisiae)"
                     /protein_id="AAH11713.1"
                     /db_xref="GeneID:55039"
                     /db_xref="HGNC:HGNC:26091"
                     /translation="MRENVVVSNMERESGKPVAVVAVVTEPRFTQRYREYLQRQKLFD
                     TQHRVEKMPDGSVALPVLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCS
                     PAQKLCLEVSRWVEGRGVKWSAELEADLPRSWQRHGNLLLLSEDCFQAKQWKNLGPEL
                     WETVALALGVQRLAKRGRVSPDGTRTPAVTLLLGDHGWVEHVDNGIRYKFDVTQCMFS
                     FGNITEKLRVASLSCAGEVLVDLYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRN
                     NLEINGVADRCQIHFGDNRKLKLSNIADRVILGLIPSSEEGWPIACQVLRQDAGGILH
                     IHQNVESFPGKNLQALGVSKVEKEHWLYPQQITTNQWKNGATRDSRGKMLSPATKPEW
                     QRWAESAETRIATLLQQVHGKPWKTQILHIQPVKSYAPHVDHIVLDLECCPCPSVG"
BASE COUNT          532 a          425 c          565 g          520 t
ORIGIN      
        1 ggcatggccg ggtgagctgc aggcttcctt atttaagacc gggaatttag tcagcctggt
       61 gagccgactc tgaggagatg gagtatcgct gaggtgatga gagagaatgt ggttgttagc
      121 aacatggaga gagaaagtgg gaagcccgtg gctgttgtcg cagttgtgac tgagcctcgg
      181 tttacccagc gatacagaga atatctccag aggcagaaac tctttgatac acagcaccgt
      241 gtggaaaaga tgccggatgg ctcggtggcg ctaccggtgc tgggagagac gcttccagag
      301 cagcacctgc aggagctgag gaatcgtgtt gccccaggca gtccctgtat gctcacgcag
      361 ctcccggatc ctgttccttc gaagagggcc cagggttgtt cacctgccca aaaattgtgt
      421 cttgaggtga gtcgctgggt ggagggtcgg ggagtcaagt ggtcagccga gctggaggct
      481 gatttgcccc gatcatggca acggcatggt aatctcttgt tgctgagtga agactgtttc
      541 caagccaagc agtggaaaaa tctgggaccg gaactctggg agaccgttgc cttggcactt
      601 ggcgtccagc gtttggcaaa acgagggcgg gtatcaccgg atggtactcg aactccagca
      661 gtgacactgc tgctgggtga ccatggctgg gtagagcatg tggataatgg tatccgttat
      721 aagtttgacg tgacccagtg tatgttctcc tttggaaaca tcactgagaa gcttcgagtg
      781 gcatcgttgt cctgtgctgg agaagtgctg gtggatctct atgcagggat tggttatttt
      841 acattgcctt tcctagttca tgctggtgct gccttcgtcc atgcttgtga gtggaatccc
      901 catgctgtag ttgctctgag aaataacctt gagatcaatg gagtagcaga tcggtgccaa
      961 atacactttg gagataacag aaaactgaag ctctcaaata ttgcagatag ggtgatcctg
     1021 gggctgattc ccagctctga agaaggctgg cccattgcct gccaagtgtt aaggcaggat
     1081 gctggaggca ttttgcatat ccaccaaaat gtggaatctt tcccagggaa gaatcttcag
     1141 gctcttggag tcagcaaagt agagaaagag cattggctgt atcctcagca aattaccacc
     1201 aaccaatgga aaaatggagc taccagggat tctaggggaa aaatgctgtc accagccacc
     1261 aagccagagt ggcaaaggtg ggcagaatct gcagaaactc gaatcgccac tcttcttcag
     1321 caggtgcatg ggaaaccatg gaagacacaa attctgcaca tccaaccagt gaaatcctat
     1381 gctccccatg tggatcacat agtcctggat ctggaatgct gcccctgtcc ttcagttggc
     1441 tagaggaggt agatcctggg acacatggga tccacgtgcg agtggccctt aaatgtatca
     1501 gttcagtcca ggttgtcatc ccttttgtcc cctggtgatc agtttttttc atattttata
     1561 gccctgaaag caggctctag atcaattcaa attatttcat ttgtctttca ttgataacag
     1621 aaaatgaaat acctgtttgg gagaagcagc atggcccatt gaaatgaggc tcatctgtgc
     1681 aattatgaat tccaaattct gacctcagtt ctggaattga agtttcagta tgttttggcc
     1741 tcgggtttcg ttatttgcaa aatgagagtt tctttgaact gtctcacgtg actattaagc
     1801 aactatacac aggacatcgg ttattttaga gtgaaagaca cagtgctttt tccaaattgc
     1861 tctggctacc atatagaaaa ttgactgaag gagggccaag atggaaacag agagaccagt
     1921 gaggaggctt ctgtggttgt ccaggtctga ggtgatggta acttggactc ggatggtggt
     1981 aatgggaggt agattgatat gataaataaa attgacagac caagaaaaaa aaaaaaaaaa
     2041 aa
//