LOCUS       BC011369                2199 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens trafficking protein particle complex 2-like, mRNA
            (cDNA clone MGC:8720 IMAGE:3868798), complete cds.
ACCESSION   BC011369
VERSION     BC011369.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2199)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2199)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 13 Row: i Column: 5
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 7706428.
FEATURES             Location/Qualifiers
     source          1..2199
                     /db_xref="H-InvDB:HIT000035224"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:8720 IMAGE:3868798"
                     /tissue_type="Eye, retinoblastoma"
                     /clone_lib="NIH_MGC_67"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2199
                     /gene="TRAPPC2L"
                     /gene_synonym="HSPC176"
                     /db_xref="GeneID:51693"
                     /db_xref="HGNC:HGNC:30887"
     CDS             13..432
                     /gene="TRAPPC2L"
                     /gene_synonym="HSPC176"
                     /codon_start=1
                     /product="trafficking protein particle complex 2-like"
                     /protein_id="AAH11369.1"
                     /db_xref="GeneID:51693"
                     /db_xref="HGNC:HGNC:30887"
                     /translation="MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKIS
                     AMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRK
                     LHNSYTDVMCNPFYNPGDRIQSRAFDNMVTSMMIQVC"
BASE COUNT          471 a          589 c          667 g          472 t
ORIGIN      
        1 gagcctccca agatggcggt gtgcatcgcg gtgattgcca aggagaatta ccccctctac
       61 attcgcagca cccctacgga gaacgagctg aagttccact acatggtgca cacatctctg
      121 gacgtggtgg atgagaagat ctccgcaatg gggaaggccc tggtcgacca gagggagctg
      181 tacctgggcc tgctctaccc cacggaggac tacaaggtat acggctacgt caccaactcc
      241 aaggtgaagt ttgtcatggt ggtagattcc tccaacacag cccttcgaga caacgaaatt
      301 cgcagcatgt tccggaagct acacaactcc tacacagacg tgatgtgcaa ccccttctac
      361 aacccggggg accgcatcca gtccagggcc tttgataaca tggtgacgtc gatgatgata
      421 caggtgtgct gagtgagctg tgctgccagc catcgcagag gagcccgcgc acgactgtgg
      481 tggggccgtc ggtctgttct ggttgcctct tcctgaatgg gacgcctggg gctttcaggg
      541 caggcagctg tgcatgttct ctcaactaaa ggtcttgtga gaggagattt ggctttttcc
      601 ttccgtgtca gccaaggatt taattaagaa gaattcaact aaggactttt ctggggtgtg
      661 ggcagaggtt tgggatcaga tggcgcaggt agcctgtcct cagttgtccc aaaggggcag
      721 aggcaggggt gcctggagcc aagagttcct gagcctgcag gacctgtgac catgtgggtc
      781 acccactggc tgaacaggtg ggctggtctg gagggggtgg cctcctgagc ccagaaccag
      841 cctaggatct aggggcacaa ggggagccgg cgtggcttcc cacaggggag ggccctcctc
      901 tttctggact tggcctccat tctttgcatc tggctcaatg tctggattcc gcccggcctt
      961 aaaaggagcc cttgtgaaac ctgggaagcc tcgtggcccc gcggcgttgg ctcagctgca
     1021 gccctggtcc taaaccttgg agcgcagact tgaggcaccc cctcctgcct gttggtgctg
     1081 agggggttgg gtgctgtgtc acttgatgac gtggctgact accacccagg gcagcggccg
     1141 agcccatagt ggcgtcagtg ccgccggcgt ccttggggtc cagcggtcaa ggctcagccc
     1201 gctgagggga cccccccgga gttggttcca gcactggtcc aggactggag agtttctcaa
     1261 ggaccttgag gaccccagaa gcccttgcag caggaaaggc tgtaaggggg ggtcagccta
     1321 gggcaggacc tagggagggg aactttcttg atacgtattt gccttttcat cccatctagc
     1381 aagcacagtg ttaattttag aaattataga agaaaaaatc agcaaggagt gtgggaaaac
     1441 tgcatgcccc aggcctcccc cgccccaggg tgaattggaa gtcctggaat gggccgaggc
     1501 acaccaggca gctgatctgg gtgcatgtgg gccacagacc actctcacaa ggttaaatct
     1561 ttaacaagag cctcatgttt gttaggagaa ggtgggaccc cagcccaagc acttccccat
     1621 tgcagcctgg catgaaatct ttgcctttta gtggggatca ctcctgcccg agtcctggct
     1681 gtggtgggga ctctgcaagt tgctaaccca gcgtccattc tctttcctcc gtactaacag
     1741 aaccccggtg cctctgccca gttccaatag cgggcagacg agagccatgt cctgggctcc
     1801 cttgcagccc ggggtgtgca gctgtggcgt ggaggtgggt ggtgctggga gagacttgca
     1861 gggaagctcc tgtgaagggg actcagctgc cacatgcagg acccttcccc tttgccttct
     1921 tcctgcctgg aacatggatg tgatggctgg tgctgggaca gctgtcctga gagcgtgagg
     1981 aaagggtcac accctaagga cagtggagca gaacacagga aggaccctgg gcctttgctg
     2041 acgcagaacg cgggaaggac gctgggcctt tgctgacgca gaacgcggga aggaccctgg
     2101 gcctttgctg acataccagc cccagactac ttaaattcag cttttttttt aatgtgagaa
     2161 aataaatgca cccctctctg gtttaaaaaa aaaaaaaaa
//