LOCUS       BC011239                1885 bp    mRNA    linear   HUM 07-OCT-2003
DEFINITION  Homo sapiens transcobalamin II; macrocytic anemia, mRNA (cDNA clone
            MGC:17407 IMAGE:4153362), complete cds.
ACCESSION   BC011239
VERSION     BC011239.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1885)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1885)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: David N. Louis, M.D.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 19 Row: j Column: 6.
FEATURES             Location/Qualifiers
     source          1..1885
                     /db_xref="H-InvDB:HIT000035198"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:17407 IMAGE:4153362"
                     /tissue_type="Brain, anaplastic oligodendroglioma with
                     1p/19q loss"
                     /clone_lib="NCI_CGAP_Brn67"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1885
                     /gene="TCN2"
                     /gene_synonym="D22S676"
                     /gene_synonym="D22S750"
                     /gene_synonym="TC2"
                     /db_xref="GeneID:6948"
                     /db_xref="MIM:275350"
     CDS             129..1331
                     /gene="TCN2"
                     /gene_synonym="D22S676"
                     /gene_synonym="D22S750"
                     /gene_synonym="TC2"
                     /codon_start=1
                     /product="TCN2 protein"
                     /protein_id="AAH11239.1"
                     /db_xref="GeneID:6948"
                     /db_xref="MIM:275350"
                     /translation="MRHLGAFLFLLGVLGALTEMCEIPEMDSHLVEKLGQHLLPWMDR
                     LSLEHLNPSIYVGLRLSSLQAGTKEDLYLHSLKLGYQQCLLGSAFSEDDGDCQGKPSM
                     GQLALYLLALRANWHDHKGHPHTSYYQYGLGILALCLHQKRVHDSVVDKLLYAVEPFH
                     QGHHSVDTAAMAGLAFTCLKRSNFNPGRRQRITMAIRTVREEILKAQTPEGHFGNVYS
                     TPLALQFLMTSPMRGAELGTACLKARVALLASLQDGAFQNALMISQLLPVLNHKTYID
                     LIFPDCLAPRVMLEPAAETIPQTQEIISVTLQVLSLLPPYRQSISVLAGSTVEDVLKK
                     AHELGGFTYETQASLSGPYLTSVMGKAAGEREFWQLLRDPNTPLLQGIADYRPKDGET
                     IELRLVSW"
     misc_feature    180..1328
                     /gene="TCN2"
                     /gene_synonym="D22S676"
                     /gene_synonym="D22S750"
                     /gene_synonym="TC2"
                     /note="Cobalamin_bind; Region: Eukaryotic
                     cobalamin-binding protein"
                     /db_xref="CDD:pfam01122"
BASE COUNT          403 a          583 c          502 g          397 t
ORIGIN      
        1 ggattaatca gtgacaggaa gctgcgtctc tcggagcggt gaccagctgt ggtcaggaga
       61 gcctcagcag ggccagcccc aggagtcttt cccgattctt gctcactgct cacccacctg
      121 ctgctgccat gaggcacctt ggggccttcc tcttccttct gggggtcctg ggggccctca
      181 ctgagatgtg tgaaatacca gagatggaca gccatctggt agagaagttg ggccagcacc
      241 tcttaccttg gatggaccgg ctttccctgg agcacttgaa ccccagcatc tatgtgggcc
      301 tacgcctctc cagtctgcag gctgggacca aggaagacct ctacctgcac agcctcaagc
      361 ttggttacca gcagtgcctc ctagggtctg ccttcagcga ggatgacggt gactgccagg
      421 gcaagccttc catgggccag ctggccctct acctgctcgc tctcagagcc aactggcatg
      481 atcacaaggg ccacccccac actagctact accagtatgg cctgggcatt ctggccctgt
      541 gtctccacca gaagcgggtc catgacagcg tggtggacaa acttctgtat gctgtggaac
      601 ctttccacca gggccaccat tctgtggaca cagcagccat ggcaggcttg gcattcacct
      661 gtctgaagcg ctcaaacttc aaccctggtc ggagacaacg gatcaccatg gccatcagaa
      721 cagtgcgaga ggagatcttg aaggcccaga cccccgaggg ccactttggg aatgtctaca
      781 gcaccccatt ggcattacag ttcctcatga cttcccccat gcgtggggca gaactgggaa
      841 cagcatgtct caaggcgagg gttgctttgc tggccagtct gcaggatgga gccttccaga
      901 atgctctcat gatttcccag ctgctgcccg ttctgaacca caagacctac attgatctga
      961 tcttcccaga ctgtctggca ccacgagtca tgttggaacc agctgctgag accattcctc
     1021 agacccaaga gatcatcagt gtcacgctgc aggtgcttag tctcttgccg ccgtacagac
     1081 agtccatctc tgttctggcc gggtccaccg tggaagatgt cctgaagaag gcccatgagt
     1141 taggaggatt cacatatgaa acacaggcct ccttgtcagg cccctactta acctccgtga
     1201 tggggaaagc ggccggagaa agggagttct ggcagcttct ccgagacccc aacaccccac
     1261 tgttgcaagg tattgctgac tacagaccca aggatggaga aaccattgag ctgaggctgg
     1321 ttagctggta gcccctgagc tccctcatcc cagcagcctc gcacactccc taggcttcta
     1381 ccctccctcc tgatgtccct ggaacaggaa ctcgcctgac cctgctgcca cctcctgtgc
     1441 actttgagca atgccccctg ggatcacccc agccacaagc ccttcgaggg ccctatacca
     1501 tggcccacct tggagcagag agccaagcat cttccctggg aagtctttct ggccaagtct
     1561 ggccagcctg gccctgcagg tctcccatga aggccacccc atggtctgat gggcatgaag
     1621 catctcagac tccttggcaa aaaacggagt ccgcaggccg caggtgttgt gaagaccact
     1681 cgttctgtgg ttggggtcct gcaagaaggc ctcctcagcc cgggggctat ggccctgacc
     1741 ccagctctcc actctgctgt tagagtggca gctccgagct ggttgtggca cagtagctgg
     1801 ggagacctca gcagggctgc tcagtgcctg cctctgacaa aattaaagca ttgatggcct
     1861 gtggacctgc aaaaaaaaaa aaaaa
//