LOCUS       BC010853                1445 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transmembrane emp24 protein transport domain
            containing 3, mRNA (cDNA clone MGC:8938 IMAGE:3876465), complete
            cds.
ACCESSION   BC010853
VERSION     BC010853.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1445)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1445)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUL-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP/Gazdar
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 14 Row: a Column: 7
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 56676386.
FEATURES             Location/Qualifiers
     source          1..1445
                     /db_xref="H-InvDB:HIT000035072"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:8938 IMAGE:3876465"
                     /tissue_type="Lung, large cell carcinoma"
                     /clone_lib="NIH_MGC_68"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..1445
                     /gene="TMED3"
                     /gene_synonym="P24B"
                     /db_xref="GeneID:23423"
                     /db_xref="HGNC:HGNC:28889"
     CDS             134..787
                     /gene="TMED3"
                     /gene_synonym="P24B"
                     /codon_start=1
                     /product="transmembrane emp24 protein transport domain
                     containing 3"
                     /protein_id="AAH10853.1"
                     /db_xref="GeneID:23423"
                     /db_xref="HGNC:HGNC:28889"
                     /translation="MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEE
                     VEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCF
                     SNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTH
                     YRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS"
BASE COUNT          318 a          403 c          415 g          309 t
ORIGIN      
        1 cggaagcgca gagctccgct ggtgccacgt ttatcccctt acatcctcct aggacccggt
       61 cggtagtcgt cgccccagcc cgccgggggc gcagcgcccg agccgcggcc ctcgagacgg
      121 gaccgagagc atcatgggca gcactgtccc gcgctccgcc tccgtgctgc ttctgctgct
      181 gctcctgcgc cgggccgagc agccctgcgg ggccgagctc accttcgagc tgccggacaa
      241 cgccaagcag tgcttccacg aggaggtgga gcagggcgtg aagttctccc tggattacca
      301 ggtcatcact ggaggccact acgatgttga ctgctatgta gaggaccccc aggggaacac
      361 catctacaga gaaacgaaga agcagtacga cagcttcacg taccgggctg aagtcaaggg
      421 cgtttatcag ttttgcttca gtaatgagtt ttccaccttc tctcacaaga ccgtctactt
      481 tgactttcaa gtgggcgatg agcctcccat tctcccagac atggggaaca gggtcacagc
      541 tctcacccag atggagtccg cctgcgtgac catccatgag gctctgaaaa cggtgattga
      601 ctcccagacg cattaccggc tgcgggaggc ccaggaccgg gcccgagcgg aagaccttaa
      661 tagccgagtc tcttactggt ctgttggcga gacgattgcc ctgttcgtgg tcagcttcag
      721 tcaggtgcta ctgttgaaaa gcttcttcac agaaaaacga cccatcagca gggcagtcca
      781 ctcctagccc cggcatcctg ctctagggcc cctcatgccc caggctggag cagctctcct
      841 aggtcacagc ctgctgggct gggtcgcgta gcccagggtg gaggcagaac gatgctgctg
      901 tggtagccct ttgcctttca tgcccatgct tgattcttgc acctcagcag ctgaaggtct
      961 cagagaccag taatcagaag gcatccgact gcattaagtg tgcagcgctg aaaagacatt
     1021 tacaactagg ccagggatta gccactgtgg gagggtggac aggcaatggt tcagtggcct
     1081 ggctgttggc aggaactcca agtgcccagg cctcttgggc agcttagggc cctgcctctg
     1141 tttcatgatg catgggtcat ttgtcttggg tgtcctatcc catatggaga agaaaggggc
     1201 tctaagttct ggctcttctt tctttggggt tctctgtacc tgaggaaacc aggccctggg
     1261 tgactttgca gatctgctca ccctcggtga gcaacagtgt cagccatgca agcaggacag
     1321 aatggtgact gggtgccctt ggtgagctgt gtatttccta ggaggtagaa aactgtggga
     1381 aactgtggct aataaaaact aagtgtgagc gtcctggaaa aaaaaaaaaa aaaaaaaaaa
     1441 aaaaa
//