LOCUS       BC010576                2038 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transcription factor AP-4 (activating enhancer binding
            protein 4), mRNA (cDNA clone MGC:17100 IMAGE:4181538), complete
            cds.
ACCESSION   BC010576
VERSION     BC010576.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2038)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2038)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUL-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: David N. Louis, M.D.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 12 Row: k Column: 15
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 4507446.
FEATURES             Location/Qualifiers
     source          1..2038
                     /db_xref="H-InvDB:HIT000035005"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:17100 IMAGE:4181538"
                     /tissue_type="Brain, anaplastic oligodendroglioma with
                     1p/19q loss"
                     /clone_lib="NCI_CGAP_Brn67"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2038
                     /gene="TFAP4"
                     /gene_synonym="AP-4"
                     /db_xref="GeneID:7023"
                     /db_xref="HGNC:HGNC:11745"
                     /db_xref="MIM:600743"
     CDS             144..1160
                     /gene="TFAP4"
                     /gene_synonym="AP-4"
                     /codon_start=1
                     /product="transcription factor AP-4 (activating enhancer
                     binding protein 4)"
                     /protein_id="AAH10576.1"
                     /db_xref="GeneID:7023"
                     /db_xref="HGNC:HGNC:11745"
                     /db_xref="MIM:600743"
                     /translation="MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQ
                     ERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQE
                     KTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQ
                     QLDKERSVRMMLEEQVRSLEAHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQQ
                     LRTQLLPPPAPTHHPTVIVPAPPPPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAI
                     QHIEGTQEKQELEEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGD
                     GELP"
BASE COUNT          436 a          596 c          552 g          454 t
ORIGIN      
        1 ctcgccgccg ccgccgccgc cagcatctgg gaccggccga ttctgcacct ccgtccggcg
       61 ctgccctttg attcggattt ccatcttgca ttctccggct gatcgcggga cctggctcgt
      121 gcagaggagg ggggccgatc gctatggagt atttcatggt gcccactcag aaggtgccct
      181 ctttgcaaca tttcaggaaa acagagaaag aagtgatagg agggctctgt agccttgcca
      241 acattccact aacccccgag actcagcggg accaggagcg gcggattcgg cgggagatcg
      301 ccaacagcaa cgagcggaga cgcatgcaga gcatcaacgc gggattccag tccctcaaga
      361 ccctcatccc ccacacagac ggagagaagc tcagcaaggc agccattctc cagcagacag
      421 ccgagtacat cttctccctg gagcaggaga agaccaggct cttgcagcag aacacacagc
      481 tcaagcgctt catccaggag ctgagcggct cgtcccccaa gcgacggcgg gcagaggaca
      541 aggacgaagg cataggctcc ccggacatct gggaggacga gaaggcggag gacctgcggc
      601 gggagatgat tgagctgcgg cagcagctgg acaaggagcg ctcggtgcgc atgatgctgg
      661 aggagcaggt gcgctcgctg gaggcccaca tgtacccgga aaagctcaag gtgattgcgc
      721 agcaggtgca gctgcagcag cagcaggaac aggtgaggct gctgcaccag gagaagctgg
      781 agcgggaaca gcagcagctg cggacccagc ttctgccccc tccggccccc acccaccacc
      841 ccacggtgat cgtgccagca ccgcctcctc ctccctccca ccacatcaat gtcgtcacca
      901 tgggcccctc ctcggtcatc aactctgttt ccacatcccg gcaaaatctg gacaccatcg
      961 tgcaggcaat ccagcacatc gagggcaccc aggaaaagca ggagctggag gaggagcagc
     1021 ggcgagctgt catcgtgaag cctgtccgca gctgcccgga ggcccccacc tctgacaccg
     1081 cctccgactc cgaggcctca gacagtgacg ccatggacca gagccgggag gagccgtcgg
     1141 gggacgggga gcttccctga ctaccccccc agccctcctc tcccttctgg gggctggagg
     1201 gagccggggc agccacaggg agagacatgg gcgaatgagt gagaaatttt tacaaaatta
     1261 cgatgtcatt tgggtctctt ttatgacctc tttttcaata ctgtaaatcg acctttgaac
     1321 gaagccactc aacccgaggt cccggggctg gggtgtcgca gagcgtgtgg gagcatcggc
     1381 accccagggc ggggcctcgg ccccgggggc tggaggaagc tgacacggag atgcctggcc
     1441 tctctctgcc aaaaagcatt ttttccttta aatatgtttt ttaagaacag ggaaaattaa
     1501 acaaaacccc aggttatttc ttccctgccc agagccagcc tgggattgtc agccttcaat
     1561 cccctttcct tcctcttttt gggttttctt ctttctcctt taagcactta catggttggg
     1621 ggtaagacta ggctggggca ttctgggggc ccggaggtct ccgttgcttc ttggttgggg
     1681 tttgctgctg ctgtgccccc ctcccccttc cccatctcgg cactagaatt cgccactctc
     1741 ccacccccca gcccccacct ctgcctccag gtctcatctt ccaccccaaa aatgtctgtc
     1801 tctctctttt tgttttgttt gttgttggtt ttttatttct ttttggtttg ctttctgttt
     1861 ttgttttgtt tttctttttt ttctttcttt tttttttttt ttacaatttt gaggtcttcg
     1921 tgttcaagga gaagctatta tattttgtta agaaagtggg gagaaaaaaa ccaagaggcc
     1981 accgtgcctt tgtaaagaaa caaaataaag tttgtacttt gttaaaaaaa aaaaaaaa
//