LOCUS       BC010097                1221 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens zinc finger protein 581, mRNA (cDNA clone MGC:19687
            IMAGE:3504825), complete cds.
ACCESSION   BC010097
VERSION     BC010097.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1221)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1221)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC010097.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 27 Row: c Column: 14
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 50592985.
FEATURES             Location/Qualifiers
     source          1..1221
                     /db_xref="H-InvDB:HIT000034796"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:19687 IMAGE:3504825"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_21"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1221
                     /gene="ZNF581"
                     /gene_synonym="FLJ22550"
                     /gene_synonym="HSPC189"
                     /db_xref="GeneID:51545"
                     /db_xref="HGNC:HGNC:25017"
     CDS             147..740
                     /gene="ZNF581"
                     /gene_synonym="FLJ22550"
                     /gene_synonym="HSPC189"
                     /codon_start=1
                     /product="zinc finger protein 581"
                     /protein_id="AAH10097.1"
                     /db_xref="GeneID:51545"
                     /db_xref="HGNC:HGNC:25017"
                     /translation="MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQA
                     SSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYL
                     QRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGEL
                     AQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP"
BASE COUNT          247 a          390 c          350 g          234 t
ORIGIN      
        1 tctctttcgg ccggcgccgc cagttcctgg ggcacaccca gaggtcccct tctcgccgcc
       61 gcctgcaact gcgagggtag cccggggccg cttggagtcg cccggacctg agaggctgct
      121 gcactgggcc tcagccagcc ctccggatgc tggtgctgcc atccccctgc cctcagcctc
      181 tggcattttc ctccgttgag accatggagg gccctccccg tcggacttgc cgctccccag
      241 aacctggacc ttcctcctcc atcggatctc cccaggcttc atctcctcca aggcccaacc
      301 actacctgct tattgacact cagggtgtcc cctacacagt gctggtggac gaggagtcac
      361 agagggagcc aggggccagt ggggctccag gccagaaaaa gtgctacagc tgccccgtgt
      421 gctcaagggt cttcgagtac atgtcctacc ttcagcgaca cagcatcacc cactcggagg
      481 taaagccctt cgagtgtgac atctgtggga aggcattcaa gcgcgccagc cacttggcac
      541 ggcaccattc cattcacctg gcgggtggtg ggcggcccca cggctgcccg ctctgccctc
      601 gccgcttccg ggatgcgggt gagctggccc agcacagccg ggtgcactct ggggaacgcc
      661 cgtttcagtg tccacactgc cctcgccgct ttatggagca gaacacactg cagaaacaca
      721 cgcggtggaa gcatccatga gccgggctgc cgggtgcccc aggtaccaca ggactttgca
      781 gggagcctgg actcctgtcc agacacctgg tgagagcctg aggctggtgt tcagggccct
      841 ggacacagac acagagcagc cgcatctcaa aggcagagcc ctgcctgaag gaggaatccg
      901 tgagtaatct tcaggtcctc cgtgttctgg agctgagatg ggaatgagcc cctacacaga
      961 atggagtcct ctagcctaaa gatatcagct gttccatggc agagccttga ctggatggag
     1021 gtggggagtg tggtgtgtaa agtctctggc ctcataaaag gtggctgtgg gtcgtcagga
     1081 atctgcgcca tcttcctggg gcttctgcgc tgttgttggg gaagggaccc cagtcctgcc
     1141 ttccaccccc caaccaggcc tgagactgat caaacaataa acacgtttcc cactctgaaa
     1201 aaaaaaaaaa aaaaaaaaaa a
//