LOCUS       BC009978                1540 bp    mRNA    linear   HUM 08-SEP-2006
DEFINITION  Homo sapiens actin, alpha, cardiac muscle 1, mRNA (cDNA clone
            MGC:16637 IMAGE:4121697), complete cds.
ACCESSION   BC009978
VERSION     BC009978.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1540)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1540)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-JUL-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced gi:14602985.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 26 Row: d Column: 12
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 46411161.
FEATURES             Location/Qualifiers
     source          1..1540
                     /db_xref="H-InvDB:HIT000034710"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:16637 IMAGE:4121697"
                     /tissue_type="Muscle, rhabdomyosarcoma"
                     /clone_lib="NIH_MGC_17"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1540
                     /gene="ACTC1"
                     /gene_synonym="CMD1R"
                     /db_xref="GeneID:70"
                     /db_xref="HGNC:143"
                     /db_xref="MIM:102540"
     CDS             206..1339
                     /gene="ACTC1"
                     /gene_synonym="CMD1R"
                     /codon_start=1
                     /product="actin, alpha, cardiac muscle 1"
                     /protein_id="AAH09978.1"
                     /db_xref="GI:14602986"
                     /db_xref="GeneID:70"
                     /db_xref="HGNC:143"
                     /db_xref="MIM:102540"
                     /translation="MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQG
                     VMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEE
                     HPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDG
                     VTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKL
                     CYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGI
                     HETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP
                     PERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF"
BASE COUNT          358 a          455 c          374 g          353 t
ORIGIN      
        1 cctcggcagt cctagcgggt gcgaagggga ccaaataagg caaggtggca gaccgggccc
       61 cccacccctg cccccggctg ctccaactga ccctgtccat cagcgttcta taaagcggcc
      121 ctcctggagc cagccaccca gagcccgctg ccgccggagc cgagccgacc cgccccgccg
      181 acgaaccccc tgaagctgtg ccaagatgtg tgacgacgag gagaccaccg ccctggtgtg
      241 cgacaacggc tctgggctgg tgaaggccgg ctttgcgggc gatgacgcgc cccgcgctgt
      301 cttcccgtcc atcgtgggcc gcccgcggca ccagggagtt atggtgggta tgggtcagaa
      361 ggactcctac gtaggtgatg aagcccagag caagagaggc atcctgaccc tgaagtatcc
      421 catcgagcat ggtatcatca ccaactggga cgacatggag aagatctggc accacacctt
      481 ctacaatgag ctccgtgtgg ctcccgagga gcaccccacc ctgctcacag aggccccgct
      541 gaaccccaag gccaaccggg agaagatgac tcagatcatg tttgagacct tcaatgtccc
      601 tgccatgtac gtggccatcc aggcagtgct atccctgtat gcttctggcc gtaccacagg
      661 cattgttctg gactctgggg atggtgtaac tcacaatgtc cccatctatg agggctacgc
      721 tttgccccat gccatcatgc gtctggatct ggctggtcgg gacctcactg actacctcat
      781 gaagatcctc actgagcgtg gctactcctt tgtcaccact gctgaacgtg aaattgtccg
      841 tgacattaaa gagaagctgt gctatgtcgc cctggatttt gagaatgaga tggccacagc
      901 tgcctcttcc tcctccctgg agaagagcta tgaactgcct gatggccaag tcatcactat
      961 tggcaatgag cgcttccgct gtcctgagac actcttccag ccctccttca ttggtatgga
     1021 atctgctggc atccatgaaa caacttacaa tagcatcatg aagtgtgaca ttgatatccg
     1081 caaggacctg tatgccaaca atgtcttatc tggaggcacc actatgtacc ctggtattgc
     1141 tgatcgtatg cagaaggaaa tcactgctct ggctcctagc accatgaaga ttaagattat
     1201 tgctccccct gagcgtaaat actctgtctg gattgggggc tccatcctgg cctctctgtc
     1261 caccttccag caaatgtgga ttagcaagca agagtacgat gaggcaggcc catccattgt
     1321 ccaccgcaaa tgcttctaag atgccttctc tctccatcta ccttccagtc aggatgacgg
     1381 tattatgctt cttggagtct tccaaaccac cttccctcat ctttcatcaa tcattgtaca
     1441 gtttgtttac acacgtgcaa tttgtttgtg cttctaatat ttattgcttt ataaataaac
     1501 cagaccagga cttgcaacct aaaaaaaaaa aaaaaaaaaa
//