LOCUS       BC009506                 745 bp    mRNA    linear   HUM 11-SEP-2007
DEFINITION  Homo sapiens TIP41, TOR signaling pathway regulator-like (S.
            cerevisiae), mRNA (cDNA clone MGC:3794 IMAGE:3532344), complete
            cds.
ACCESSION   BC009506
VERSION     BC009506.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 745)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 745)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Oct 31, 2003 this sequence version replaced BC009506.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 11 Row: h Column: 11
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 33239373.
FEATURES             Location/Qualifiers
     source          1..745
                     /db_xref="H-InvDB:HIT000034412"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:3794 IMAGE:3532344"
                     /tissue_type="Muscle, rhabdomyosarcoma"
                     /clone_lib="NIH_MGC_17"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..745
                     /gene="TIPRL"
                     /gene_synonym="dJ69E11.3"
                     /gene_synonym="RP1-69E11.1"
                     /db_xref="GeneID:261726"
                     /db_xref="HGNC:HGNC:30231"
     CDS             24..560
                     /gene="TIPRL"
                     /gene_synonym="dJ69E11.3"
                     /gene_synonym="RP1-69E11.1"
                     /codon_start=1
                     /product="TIP41, TOR signaling pathway regulator-like (S.
                     cerevisiae)"
                     /protein_id="AAH09506.1"
                     /db_xref="GeneID:261726"
                     /db_xref="HGNC:HGNC:30231"
                     /translation="MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPS
                     LPEMMFGDNVLRIQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSK
                     EVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEKLKAREQIKFFEEVLLFEDEL
                     HDHGVSSLSVKIPGGGHL"
BASE COUNT          244 a          153 c          186 g          162 t
ORIGIN      
        1 cctctgcggg tcctgcctca gccatgatga tccacggctt ccagagcagc caccgggatt
       61 tctgcttcgg gccctggaag ctgacggcgt ccaagaccca catcatgaag tcggcggatg
      121 tggagaaatt agccgatgaa ttacatatgc catctctccc tgaaatgatg tttggagaca
      181 acgttttaag aatccagcat gggtctggct ttggaattga gttcaatgct acagatgcgt
      241 taagatgtgt aaacaactac caaggaatgc ttaaagtggc ctgtgctgaa gagtggcaag
      301 aaagcaggac ggagggtgaa cactccaaag aggttattaa accatatgat tggacctata
      361 caacagatta taagggaacc ttacttggag aatctcttaa gttaaaggtt gtacctacaa
      421 cagatcatat agatacagaa aaattgaaag ccagagaaca gattaagttt tttgaagaag
      481 ttctcctttt tgaggatgaa cttcatgatc atggagtttc aagcctgagt gtgaagattc
      541 ctggtggcgg gcacctgtag tcccagctac tcgggaggct gaggcaggag aagcgtgaac
      601 ccgggaggcg gagcttgcag tgagctgaga tcgcaccact gcactccagc cctccagcct
      661 gggcgacaga gcaagactcc gtctcaaaaa aaaaaaaata aaataaaata aaagaagtag
      721 aaaacacaaa aaaaaaaaaa aaaaa
//