LOCUS       BC009349                2242 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transcription factor 25 (basic helix-loop-helix), mRNA
            (cDNA clone MGC:14951 IMAGE:4136178), complete cds.
ACCESSION   BC009349
VERSION     BC009349.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2242)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2242)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUN-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Dec 9, 2003 this sequence version replaced BC009349.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 26 Row: m Column: 2
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 14149656.
FEATURES             Location/Qualifiers
     source          1..2242
                     /db_xref="H-InvDB:HIT000034298"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:14951 IMAGE:4136178"
                     /tissue_type="Brain, neuroblastoma"
                     /clone_lib="NIH_MGC_19"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2242
                     /gene="TCF25"
                     /gene_synonym="FKSG26"
                     /gene_synonym="hKIAA1049"
                     /gene_synonym="Hulp1"
                     /gene_synonym="KIAA1049"
                     /gene_synonym="NULP1"
                     /gene_synonym="PRO2620"
                     /db_xref="GeneID:22980"
                     /db_xref="HGNC:HGNC:29181"
     CDS             28..2058
                     /gene="TCF25"
                     /gene_synonym="FKSG26"
                     /gene_synonym="hKIAA1049"
                     /gene_synonym="Hulp1"
                     /gene_synonym="KIAA1049"
                     /gene_synonym="NULP1"
                     /gene_synonym="PRO2620"
                     /codon_start=1
                     /product="transcription factor 25 (basic
                     helix-loop-helix)"
                     /protein_id="AAH09349.1"
                     /db_xref="GeneID:22980"
                     /db_xref="HGNC:HGNC:29181"
                     /translation="MSRRALRRLRGEQRGQEPLGPGALHFDLRDDDDAEEEGPKRELG
                     VRRPGGAGKEGVRVNNRFELINIDDLEDDPVVNGERSGCALTDAVAPGNKGRGQRGNT
                     ESKTDGDDTETVPSEQSHASGKLRKKKKKQKNKKSSTGEASENGLEDIDRILERIEDS
                     TGLNRPGPAPLSSRKHVLYVEHRHLNPDTELKRYFGARAILGEQRPRQRQRVYPKCTW
                     LTTPKSTWPRYSKPGLSMRLLESKKGLSFFAFEHSEEYQQAQHKFLVAVESMEPNNIV
                     VLLQTSPYHVDSLLQLSDACRFQEDQEMARDLVERALYSMECAFHPLFSLTSGACRLD
                     YRRPENRSFYLALYKQMSFLEKRGCPRTALEYCKLILSLEPDEDPLCMLLLIDHLALR
                     ARNYEYLIRLFQEWEAHRNLSQLPNFAFSVPLAYFLLSQQTDLPECEQSSARQKASLL
                     IQQALTMFPGVLLPLLESCSVRPDASVSSHRFFGPNAEISQPPALSQLVNLYLGRSHF
                     LWKEPATMSWLEENVHEVLQAVDAGDPAVEACENRRKVLYQRAPRNIHRHVILSEIKE
                     AVAALPPDVTTQSVMGFDPLPPSDTIYSYVRPERLSPISHGNTIALFFRSLLPNYTME
                     GERPEEGVAGGLNRNQGLNRLMLAVRDMMANFHLNDLEAPHEDDAEGEGEWD"
BASE COUNT          535 a          638 c          660 g          409 t
ORIGIN      
        1 ctccagacgt cgtggtcgtt cggtcctatg tcgcgccggg ccctccggag gctgaggggg
       61 gaacagcgcg gccaggagcc cctcgggccc ggcgccttgc atttcgatct ccgtgatgac
      121 gatgacgcgg aagaagaagg gcccaagcgg gagcttggtg tccggcgtcc cgggggcgca
      181 gggaaggagg gcgtccgagt caacaaccgc ttcgagctga taaacattga cgatcttgag
      241 gatgaccctg tggtgaacgg ggagaggtct ggctgtgcgc tcacagacgc tgtggcacca
      301 gggaacaaag gaaggggtca gcgtggaaac acagagagca agacggatgg agatgacacc
      361 gagacagtgc cctcagagca gtctcatgca agtggcaaac tccggaagaa gaaaaaaaaa
      421 cagaaaaaca agaaaagcag cacgggagaa gcatcggaaa acggactaga agatatcgat
      481 cgcatcctag agaggattga ggacagcact gggttgaacc gtcccggccc agctcccctg
      541 agctccagga agcacgttct ctacgtggag cacagacact tgaatccaga cacagaactg
      601 aaaaggtatt ttggtgcccg ggcaatcctg ggggagcaaa ggccacggca gagacaacgt
      661 gtgtacccca agtgcacatg gctgaccacc cctaaaagca cctggccccg ctacagcaaa
      721 ccaggtctgt ccatgcggct gctggaatca aaaaaaggcc tctccttctt tgcgtttgag
      781 cacagtgagg agtaccagca ggctcagcac aagttcctgg tggccgtgga gtctatggag
      841 ccgaacaaca tcgtggttct gctccagacg agcccttacc acgttgactc actcctgcag
      901 ctcagcgatg cctgccgctt tcaagaggat caggagatgg ctcgagacct cgtagagaga
      961 gcgctgtaca gcatggaatg tgcgttccac cccctgttca gtctcaccag tggggcctgc
     1021 cggctggatt accgcagacc cgagaacagg agcttctacc tggccctcta caagcagatg
     1081 agcttcctgg agaagcgagg ctgcccgcgc acggcgctgg agtactgcaa gctcatcctg
     1141 agtctcgagc cggatgagga ccccctctgc atgctgctgc tcatcgacca cctggccttg
     1201 cgggcccgga actacgagta cctgatccgc ctcttccagg agtgggaggc tcatcggaac
     1261 ctgtcccagc tccctaattt tgccttctct gttccactgg cgtatttcct gctgagccag
     1321 cagacagacc tccctgagtg tgagcagagc tctgccaggc agaaggcctc tctcctgata
     1381 cagcaggcgc tcaccatgtt ccctggagtc ctcctgcccc tgctcgagtc ttgcagtgtg
     1441 cggcccgacg ccagcgtttc cagtcaccgc ttctttggac ccaatgctga aataagccag
     1501 ccccctgccc tgagccagct ggtgaacctg taccttggga ggtcacactt tctctggaaa
     1561 gagcccgcca ccatgagctg gctggaggag aacgtccacg aggttctgca agcagtggac
     1621 gccggggacc cagccgtgga agcctgtgag aaccggcgga aggtgctcta ccagcgtgca
     1681 cccaggaata tccaccgcca tgtgatcctc tctgagatca aggaagccgt cgctgccctg
     1741 cccccggacg tgaccacgca gtctgtgatg gggtttgatc ctctgcctcc ttcggacaca
     1801 atctactcct acgtcaggcc agagaggcta agtcctatca gccatggaaa caccattgct
     1861 ctcttcttcc ggtcactgtt gccaaactat accatggagg gggagaggcc cgaggaagga
     1921 gtggctgggg gtctgaaccg caaccagggc ctgaacaggc tgatgctggc tgtgcgcgac
     1981 atgatggcca acttccacct caacgacctg gaggcaccgc acgaggacga cgctgagggg
     2041 gagggggagt gggactgagc gtccgcagag gtgaccgaaa agccgtatga tgatgttccc
     2101 gatttctctg ttggtcggag tcggccagtt gcctgaagta gggaagctga gtgtgtcgct
     2161 ccctggtcca ctgtttctcc tataaatgta aatgggtcac gaaaaaaaaa aaaaaaaaaa
     2221 aaaaaaaaaa aaaaaaaaaa aa
//