LOCUS       BC009221                1287 bp    mRNA    linear   HUM 16-DEC-2003
DEFINITION  Homo sapiens transportin 3, mRNA (cDNA clone IMAGE:3927816),
            partial cds.
ACCESSION   BC009221
VERSION     BC009221.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1287)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1287)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JUN-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Dec 9, 2003 this sequence version replaced BC009221.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Institute for Systems Biology
            http://www.systemsbiology.org
            contact: amadan@systemsbiology.org
            Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
            Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 25 Row: c Column: 4.
FEATURES             Location/Qualifiers
     source          1..1287
                     /db_xref="H-InvDB:HIT000087227"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3927816"
                     /tissue_type="Ovary, adenocarcinoma"
                     /clone_lib="NIH_MGC_9"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            <1..1287
                     /gene="TNPO3"
                     /gene_synonym="IPO12"
                     /gene_synonym="MTR10A"
                     /gene_synonym="TRN-SR"
                     /gene_synonym="TRN-SR2"
                     /db_xref="GeneID:23534"
     CDS             <1..977
                     /gene="TNPO3"
                     /gene_synonym="IPO12"
                     /gene_synonym="MTR10A"
                     /gene_synonym="TRN-SR"
                     /gene_synonym="TRN-SR2"
                     /codon_start=3
                     /product="TNPO3 protein"
                     /protein_id="AAH09221.2"
                     /db_xref="GeneID:23534"
                     /translation="SVQVMALKKLLSQEPSNGISSDPTVFLDRLAVIFRHTNPIVENG
                     QTHPCQKVIQEIWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQ
                     MVNVYHVHQHSCFLYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNH
                     PDTVDDLFRLATRFIQRSPVTLLRSQVVIPILQWAIASTTLDHRDANCSVMRFLRDLI
                     HTGVANDHEEDFELRKELIGQVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIM
                     QVDRPTFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTRNVFFN"
BASE COUNT          371 a          299 c          314 g          303 t
ORIGIN      
        1 gttctgttca ggttatggca ttgaaaaagc tgttgtctca agagcccagc aatggcatat
       61 cctcagatcc cacagtgttc ttagatcgcc ttgcagtgat atttaggcat accaatccca
      121 ttgtggaaaa tggacagact catccgtgtc agaaagtcat acaggaaata tggccagttt
      181 tatccgagac tctaaataag caccgagctg ataatcggat tgtagagcgt tgttgcaggt
      241 gcctgcgctt tgctgttcgc tgtgtaggca aaggatctgc agcactgctg cagccactag
      301 tcacacagat ggtgaatgtg taccacgtac atcagcattc ctgcttcctg taccttggca
      361 gtatccttgt ggatgaatat ggcatggaag aaggctgtcg gcagggactg ctagacatgc
      421 tccaggcact gtgcatcccc acctttcagc tcctagaaca gcagaatggt ctccagaatc
      481 accctgacac tgtagatgac ctgttccggc tagccaccag gtttattcag cgtagccctg
      541 tcaccttgct gcggagccaa gtggtcatcc ctatcttaca gtgggccatt gcctctacta
      601 ccctggacca ccgggatgcc aattgtagtg tcatgaggtt tctacgagac ctcattcata
      661 caggggtagc caatgatcat gaagaagact ttgaattacg gaaagaactg attggacagg
      721 tgatgaacca gcttggacag cagcttgtca gccagctgct gcacacctgc tgcttttgcc
      781 tcccccccta taccctacca gatgtggctg aagtgctctg ggagatcatg caggttgaca
      841 gaccgacttt ttgtcgatgg ttagaaaatt ccttaaaagg tttgccaaag gaaacaaccg
      901 tgggagctgt cacagtgaca cacaaacaac ttacagactt ccacaagcaa gtcactagga
      961 atgtcttttt taattagaag acaggaagaa aacaaaaacc agactgtgtc ccacaatcag
     1021 aaacctccgt tgtggcagag gggccttcac cgccaccagg gtgtcccgcc agacagggag
     1081 agactccagc cttctgaggc catcctgagg agttcctgtt tgggggtgtg agggaaaatc
     1141 agcgcggatt ttaaaaagat ggctgtggcc tgcccggcgt ggtgggaggg gagctggttt
     1201 cctggtgaac tttctaaaag gaaaaataat tttaagtaaa aaaaaaaaaa aaaaaaaaaa
     1261 aaaaaaaaaa aaaaaaaaaa aaaaaaa
//