LOCUS       BC009006                2619 bp    mRNA    linear   HUM 24-JUN-2004
DEFINITION  Homo sapiens transmembrane protein 30A, mRNA (cDNA clone MGC:16987
            IMAGE:4154200), complete cds.
ACCESSION   BC009006
VERSION     BC009006.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2619)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2619)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAY-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: David N. Louis, M.D.
            cDNA Library Preparation: Life Technologies, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Baylor College of Medicine Human Genome
            Sequencing Center
            Center code: BCM-HGSC
            Web site: http://www.hgsc.bcm.tmc.edu/cdna/
            Contact: amg@bcm.tmc.edu
            Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
            Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
            A.N., Gibbs, R.A.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAK Plate: 19 Row: d Column: 14
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 8922719.
FEATURES             Location/Qualifiers
     source          1..2619
                     /db_xref="H-InvDB:HIT000034135"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:16987 IMAGE:4154200"
                     /tissue_type="Brain, anaplastic oligodendroglioma with
                     1p/19q loss"
                     /clone_lib="NCI_CGAP_Brn67"
                     /lab_host="DH10B"
                     /note="Vector: pCMV-SPORT6"
     gene            1..2619
                     /gene="TMEM30A"
                     /gene_synonym="C6orf67"
                     /gene_synonym="FLJ10856"
                     /db_xref="GeneID:55754"
     CDS             130..1107
                     /gene="TMEM30A"
                     /gene_synonym="C6orf67"
                     /gene_synonym="FLJ10856"
                     /codon_start=1
                     /product="TMEM30A protein"
                     /protein_id="AAH09006.1"
                     /db_xref="GeneID:55754"
                     /translation="MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPI
                     LTAGTVLPIFFIIGLIFIPIGIGIFVTSNNIREIEGNVFMYYGLSNFYQNHRRYVKSR
                     DDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFNDTLELFLIGNDSYPIP
                     IALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPVYMLDSDPDNNGFIN
                     EDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPVHYFDGRKRMIL
                     STISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI"
BASE COUNT          756 a          461 c          527 g          875 t
ORIGIN      
        1 ctgtggcggt ggcgctggtg gctgcggcgg cggcggcggc agcggcgctc gagcggttcc
       61 tgtcagggtc agccggcggg ccccctgggt ggtccacctg caaatcgcgg agcggcgccc
      121 cagggatcga tggcgatgaa ctataacgcg aaggatgaag tggacggtgg gcccccgtgt
      181 gctccggggg gcaccgcgaa gactcggaga ccggataaca cggccttcaa acagcaacgg
      241 ctgccagctt ggcagcccat ccttacggct ggcacggtgc tacctatttt cttcatcatc
      301 ggtctcatct tcattcccat cggcattggc atttttgtca cctccaacaa catccgcgag
      361 atcgagggca acgtgtttat gtattatgga ctgtctaatt tctatcaaaa ccatcgtcgt
      421 tacgtgaaat ctcgagatga tagtcaacta aatggagatt ctagtgcttt gcttaatccc
      481 agtaaggaat gtgaacctta tcgaagaaat gaagacaaac caattgctcc ttgtggagct
      541 attgccaaca gcatgtttaa tgatacatta gaattgtttc tcattggcaa tgattcttat
      601 cctataccta tcgctttgaa aaagaaaggt attgcttggt ggacagataa aaatgtgaaa
      661 ttcagaaatc cccctggagg agacaacctg gaagaacgat ttaaaggtac aacaaagcct
      721 gtgaactggc ttaaaccagt ttacatgctg gattctgacc cagataataa tggattcata
      781 aatgaggatt ttattgtttg gatgcgtact gcagcattac ctacttttcg caagttgtat
      841 cgtcttatag aaaggaaaag tgatttacat ccaacattac cagctggccg atactctttg
      901 aatgtcacat acaattaccc tgtacattat tttgatggac gaaaacggat gatcttgagc
      961 actatttcat ggatgggagg aaaaaatcca tttttgggga ttgcttacat cgctgttgga
     1021 tccatctcct tccttctggg agttgtactg ctagtaatta atcataaata tagaaacagt
     1081 agtaatacag ctgacattac catttaattt tatattatga aagcaaatca tctgcatgtg
     1141 catcaaggcc agtcctattc aacctagctt tcgaatgctg atatctggtt agtatgtcat
     1201 tttgaagttg gcacataact tttctaaaaa aaagcagtct ttgttgtttg cttcttccct
     1261 acggatgact tctaaaaata tatgacgggt ataaaaaaat tagctatatt gatcatatca
     1321 acactgtaac tgctgaaatg gcattctaat gtttgctttt tattcggaca ggccacatga
     1381 tgcatagagc ctctttcatg tgacttgtgt ctactgctta aatctttatg ctgtgttgat
     1441 gatattatat tgacatatga agctgtatat gtgtatgtat tttgtggaga aagggattac
     1501 aagatgtatg agtataatga cttgctaacc tttcaggatt cagagaaaga tgaagaaaga
     1561 ccatatctaa ataatacact tcatcatttt catgtgtata aatgcttaaa gtaccatctt
     1621 tgttgaggtg gttcatgtat ccagtttatc cagtacagtt atttgtcaag cttagctttg
     1681 atttcaaagg acacgcttac cttgtctggc ataagaatta atgctcatgt ctgcagtggt
     1741 tgggtaggtc ctgcttagga gaattaaaaa attcctcttt ccgtttggtt gaatgttgca
     1801 gtcaggaacc ccaactcact tggaatgttt ttatatgtaa tcatttccct tgaagcttat
     1861 actttataag ggaagaaaga attcaggtga tatgggaaaa ctgcttggca gaccttcatc
     1921 ttctgcctca actgtaaacc acatgtaaat gcttaatgga gactgttttc attcttgtga
     1981 tatttaacat tcagaaaatt acttcagctt tggaaatact caggctgttt ttattctgca
     2041 ggtaagtgtt ttgacttaag tactaatatt ccagaaattt ttgaaagcag taaccttaat
     2101 ttcctatgta tttcattcca cttttgcata taggtcaaat agcaatgtgt atgcacattc
     2161 tctttagtta aggcaccaat tgttttggtt ggttttccta agacatactt taaaaagatg
     2221 ttctataaat ttcctagtta aattatgggg attttggagt atgtacatga taaattataa
     2281 tacgtatatg gttgaagtta ttttattttt tactaatgaa ttattttaat attccttatt
     2341 gaataaatgc tgtaacttgt ttgctatgga acttattctt aaagttctag ttaaaaataa
     2401 tttttccaca tgcatgaaaa tatgtattaa tcagaggtgg cttaattaca ttgaaattgc
     2461 ttttttgttg ttgttttttt actgaaataa ctcatgtttg tgtagaagaa tgcctgttta
     2521 ctcagagttt atattttcct tcagttatat tttaaatcaa aaggtctggg taatgtatac
     2581 ttttgattaa tatatacttt ttttaaaaaa aaaaaaaaa
//