LOCUS       BC008865                1010 bp    mRNA    linear   HUM 11-AUG-2006
DEFINITION  Homo sapiens family with sequence similarity 96, member A, mRNA
            (cDNA clone MGC:14881 IMAGE:4128736), complete cds.
ACCESSION   BC008865
VERSION     BC008865.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1010)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1010)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-MAY-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC008865.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 26 Row: i Column: 19
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 62414378.
FEATURES             Location/Qualifiers
     source          1..1010
                     /db_xref="H-InvDB:HIT000034032"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:14881 IMAGE:4128736"
                     /tissue_type="Brain, neuroblastoma"
                     /clone_lib="NIH_MGC_19"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1010
                     /gene="FAM96A"
                     /gene_synonym="FLJ22875"
                     /db_xref="GeneID:84191"
                     /db_xref="HGNC:HGNC:26235"
     CDS             143..625
                     /gene="FAM96A"
                     /gene_synonym="FLJ22875"
                     /codon_start=1
                     /product="family with sequence similarity 96, member A"
                     /protein_id="AAH08865.1"
                     /db_xref="GeneID:84191"
                     /db_xref="HGNC:HGNC:26235"
                     /translation="MQRVSGLLSWTLSRVLWLSGLSEPGAARQPRIMEEKALEVYDLI
                     RTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSLATLIGLCLRV
                     KLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAAMENPNLREIVEQCVLEPD
                     "
BASE COUNT          299 a          192 c          227 g          292 t
ORIGIN      
        1 gtctggcccc gccttttctc tgctctcctg aacctttagg cttgtctcgg cccatttgaa
       61 gaccaggaag ttgatcaatc ccgaggctgc tgagagacgg tggcgcgatt gggacagtcg
      121 ccagggatgg ctgagcgtga agatgcagcg ggtgtccggg ctgctctcct ggacgctgag
      181 cagagtcctg tggctctccg gcctctctga gccgggagct gcccggcagc cccggatcat
      241 ggaagagaaa gcgctagagg tttatgattt gattagaact atccgggacc cagaaaagcc
      301 caatacttta gaagaactgg aagtggtctc ggaaagttgt gtggaagttc aggagataaa
      361 tgaagaagaa tatctggtta ttatcaggtt cacgccaaca gtacctcatt gctctttggc
      421 gactcttatt gggctgtgct taagagtaaa acttcagcga tgtttaccat ttaaacataa
      481 gttggaaatc tacatttctg aaggaaccca ctcaacagaa gaagacatca ataagcagat
      541 aaatgacaaa gagcgagtgg cagctgcaat ggaaaacccc aacttacggg aaattgtgga
      601 acagtgtgtc cttgaacctg actgatagct gttttaagag ccactggcct gtaattgttt
      661 gatatatttg tttaaactct ttgtataatg tcagagactc atgtttaata cataggtgat
      721 ttgtacctca gagcattttt taaaggattc tttccaagcg agatttaatt ataaggtagt
      781 acctaatttg ttcaatgtat aacattctca ggatttgtaa cacttaaatg atcagacaga
      841 ataatatttt ctagttatta tgtgtaagat gagttgctat ttttctgatg ctcattctga
      901 tacaactatt tttcgtgtca aatatctact gtgcccaaat gtactcaatt taaatcatta
      961 ctctgtaaaa taaataagca gatgattctt ataaaaaaaa aaaaaaaaaa
//