LOCUS       BC007248                1530 bp    mRNA    linear   HUM 12-JUL-2001
DEFINITION  Homo sapiens, glioma tumor suppressor candidate region gene 2,
            clone IMAGE:2966906, mRNA, partial cds.
ACCESSION   BC007248
VERSION     BC007248.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1530)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-MAY-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
            Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
            Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
            Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
            Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
            Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
            Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
            George Yang, Scott Zuyderduyn, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 22 Row: c Column: 21.
FEATURES             Location/Qualifiers
     source          1..1530
                     /db_xref="H-InvDB:HIT000086771"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:2966906"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_20"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     CDS             <1..1425
                     /codon_start=1
                     /product="glioma tumor suppressor candidate region gene 2"
                     /protein_id="AAH07248.1"
                     /translation="GSGVGGKRSSKSDADSGFLGLRPTSVDPALRRRRRGPRNKKRGW
                     RRLAQEPLGLEVDQFLEDVRLQERTSGGLLSEAPNEKLFFVDTGSKEKGLTKKRTKVQ
                     KKSLLLKKPLRVDLILENTSKVPAPKDVLAHQVPNAKKLRRKEQLWEKLAKQGELPRE
                     VRRAQARLLNPSATRAKPGPQDTVERPFYDLWASDNPLDRPLVGQDEFFLEQTKKKGV
                     KRPARLHTKPSQAPAVEVAPAGASYNPSFEDHQTLLSAAHEVELQRQKEAEKLERQLA
                     LPATEQAATQESTFQELCEGLLEESDGEGEPGQGEGPEAGDAEVCPTPARLATTEKKT
                     EQQRRREKAVHRLRVQQAALRAARLRHQELFRLRGIKAQVALRLAELARRRRRRQARR
                     EAEADKPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPR
                     ERAKFKRKYKVKLVEKRAFREIQL"
BASE COUNT          374 a          438 c          515 g          203 t
ORIGIN      
        1 ggcagtggcg ttggtgggaa gcgcagctcg aaaagcgatg ccgattctgg tttcctgggg
       61 ctgcggccca cttcggtgga cccagcgctg aggcggcggc ggcgaggccc aagaaataag
      121 aagcggggct ggcggcggct tgctcaggag ccgctggggc tggaggttga ccagttcctg
      181 gaagacgtgc ggctacagga gcgcacgagc ggtggcttgt tgtcagaggc cccaaatgaa
      241 aaactcttct tcgtggacac tggctccaag gaaaaagggc tgacaaagaa gagaaccaaa
      301 gtccagaaga agtcactgct tctcaagaaa ccccttcggg ttgacctcat cctcgagaac
      361 acatccaaag tccctgcccc caaagacgtc ctcgcccacc aggtccccaa cgccaagaag
      421 ctcaggcgga aggagcagct atgggagaag ctggccaagc agggcgagct gccccgggag
      481 gtgcgcaggg cccaggcccg gctcctcaac ccttctgcaa caagggccaa gcccgggccc
      541 caggacaccg tagagcggcc cttctacgac ctctgggcct cagacaaccc cctggacagg
      601 ccgttggttg gccaggatga gtttttcctg gagcagacca agaagaaagg agtgaagcgg
      661 ccagcacgcc tgcacaccaa gccgtcccag gcgcccgccg tggaggtggc gcctgccgga
      721 gcttcctaca atccatcctt tgaagaccac cagaccctgc tctcagcggc ccacgaggtg
      781 gagttgcagc ggcagaagga ggcggagaag ctggagcggc agctggccct gcccgccacg
      841 gagcaggccg ccacccagga gtccacattc caggagctgt gcgaggggct gctggaggag
      901 tcggatggtg agggggagcc aggccagggc gaggggccgg aggctgggga tgccgaggtc
      961 tgtcccacgc ccgcccgcct ggccaccaca gagaagaaga cggagcagca gcggcggcgg
     1021 gagaaggctg tgcacaggct gcgggtacag caggccgcgt tgcgggccgc ccggctccgg
     1081 caccaggagc tgttccggct gcgcgggatc aaggcccagg tggccctgag gctggcggag
     1141 ctggcgcggc ggcggaggcg gcggcaggcg cggcgggagg ctgaggctga caagccccga
     1201 aggctgggac ggctcaagta ccaggcacct gacatcgacg tgcagctgag ctcggagctg
     1261 acagactcgc tcaggaccct gaagcccgag ggcaacatcc ttcgagaccg gttcaagagc
     1321 ttccagagga ggaatatgat cgagcctcga gagagagcca agttcaaacg caagtacaag
     1381 gtgaagctgg tggagaagcg ggcgttccgt gagatccagt tgtagctgcc atcagatgcc
     1441 ggagactcgc ccttcaataa aaaatctctt ctagctgaaa aaaaaaaaaa aaaaaaaaaa
     1501 aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
//