LOCUS       BC006997                2826 bp    mRNA    linear   HUM 07-NOV-2006
DEFINITION  Homo sapiens GTPase activating protein (SH3 domain) binding protein
            1, mRNA (cDNA clone MGC:12272 IMAGE:3950738), complete cds.
ACCESSION   BC006997
VERSION     BC006997.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2826)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2826)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-APR-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: CLONTECH
            cDNA Library Preparation: CLONTECH Laboratories, Inc.
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Sequencing Group at the Stanford Human Genome
            Center, Stanford University School of Medicine, Stanford, CA  94305
            Web site:       http://www-shgc.stanford.edu
            Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
            Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
            R. M.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 16 Row: m Column: 12
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 38327550.
FEATURES             Location/Qualifiers
     source          1..2826
                     /db_xref="H-InvDB:HIT000032975"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:12272 IMAGE:3950738"
                     /tissue_type="Prostate"
                     /clone_lib="NIH_MGC_83"
                     /lab_host="DH10B"
                     /note="Vector: pDNR-LIB"
     gene            1..2826
                     /gene="G3BP1"
                     /gene_synonym="G3BP"
                     /gene_synonym="HDH-VIII"
                     /db_xref="GeneID:10146"
                     /db_xref="HGNC:HGNC:30292"
                     /db_xref="MIM:608431"
     CDS             135..1535
                     /gene="G3BP1"
                     /gene_synonym="G3BP"
                     /gene_synonym="HDH-VIII"
                     /codon_start=1
                     /product="GTPase activating protein (SH3 domain) binding
                     protein 1"
                     /protein_id="AAH06997.1"
                     /db_xref="GI:13937794"
                     /db_xref="GeneID:10146"
                     /db_xref="HGNC:HGNC:30292"
                     /db_xref="MIM:608431"
                     /translation="MVMEKPSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGG
                     LDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNN
                     QALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEPEERQ
                     QTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPV
                     LEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVK
                     VPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMV
                     RHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQ
                     KVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGM
                     VQKPGFGVGRGLAPRQ"
BASE COUNT          817 a          535 c          624 g          850 t
ORIGIN      
        1 gtgtgcggac gcagttgcgt gaggggtttg tgctatcctc ggtgctgtgg tgcagagcta
       61 gttcctctcc agctcagccg cgtaggtttg gacatatttg actcttttcc ccccaggttg
      121 aattgaccaa agcaatggtg atggagaagc ctagtcccct gctggtcggg cgggaatttg
      181 tgagacagta ttacacactg ctgaaccagg ccccagacat gctgcataga ttttatggaa
      241 agaactcttc ttatgtccat gggggattgg attcaaatgg aaagccagca gatgcagtct
      301 acggacagaa agaaatccac aggaaagtga tgtcacaaaa cttcaccaac tgccacacca
      361 agattcgcca tgttgatgct catgccacgc taaatgatgg tgtggtagtc caggtgatgg
      421 ggcttctctc taacaacaac caggctttga ggagattcat gcaaacgttt gtccttgctc
      481 ctgaggggtc tgttgcaaat aaattctatg ttcacaatga tatcttcaga taccaagatg
      541 aggtctttgg tgggtttgtc actgagcctc aggaggagtc tgaagaagaa gtagaggaac
      601 ctgaagaaag acagcaaaca cctgaggtgg tacctgatga ttctggaact ttctatgatc
      661 aggcagttgt cagtaatgac atggaagaac atttagagga gcctgttgct gaaccagagc
      721 ctgatcctga accagaacca gaacaagaac ctgtatctga aatccaagag gaaaagcctg
      781 agccagtatt agaagaaact gcccctgagg atgctcagaa gagttcttct ccagcacctg
      841 cagacatagc tcagacagta caggaagact tgaggacatt ttcttgggca tctgtgacca
      901 gtaagaatct tccacccagt ggagctgttc cagttactgg gataccacct catgttgtta
      961 aagtaccagc ttcacagccc cgtccagagt ctaagcctga atctcagatt ccaccacaaa
     1021 gacctcagcg ggatcaaaga gtgcgagaac aacgaataaa tattcctccc caaaggggac
     1081 ccagaccaat ccgtgaggct ggtgagcaag gtgacattga accccgaaga atggtgagac
     1141 accctgacag tcaccaactc ttcattggca acctgcctca tgaagtggac aaatcagagc
     1201 ttaaagattt ctttcaaagt tatggaaacg tggtggagtt gcgcattaac agtggtggga
     1261 aattacccaa ttttggtttt gttgtgtttg atgattctga gcctgttcag aaagtcctta
     1321 gcaacaggcc catcatgttc agaggtgagg tccgtctgaa tgtcgaagag aagaagactc
     1381 gagctgccag ggaaggcgac cgacgagata atcgccttcg gggacctgga ggccctcgag
     1441 gtgggctggg tggtggaatg agaggccctc cccgtggagg catggtgcag aaaccaggat
     1501 ttggagtggg aagggggctt gcgccacggc agtgaatctt catggatctt catgcagcca
     1561 tacaaaccct ggttccaaca gaatggtgaa ttttcgacag cctttggtat cttggagtat
     1621 gaccccagtc tgttataaac tgcttaagtt tgtataattt tacttttttt gtgtgttaat
     1681 ggtgtgtgct ccctctccct ctcttccctt tcctgacctt tagtctttca cttccaattt
     1741 tgtggaatga tattttagga ataacggact tttaaagaag caaaaaaaaa agactgaatt
     1801 tccttgctta ctttgcatat acagactgga tttttttttt ttttttacag ccatttcccc
     1861 aaaggaatgt cttgcatatt actgacattt ggtatgtttc attcattgga atatttctta
     1921 ttttctacgt gtttgaaaag cctgtaagaa atacaggatt tgataatatt ttgaaggcag
     1981 gaaaaaccca aattgtttct tctttgagag tcatgactac cttctggtgt ggagaaattg
     2041 ccattggaaa atttgacaat tttgattctc actggtatgt ttaaaaactg aataaaagga
     2101 atagaatttt tttttgataa aggatcacaa aacaattcta aaacctaact gtttttacca
     2161 ttgaaattta aattgtgata ataggtttta aatgtctaga atgcaactga taggcttttc
     2221 ttgaactgtt agtttttttg aagtagtttt ttcatgttta atttgtattt gtaaaaaaac
     2281 aaaaagcaaa aaaattccca aaacccagat aacaaccaga gcaaaactgt tgtgccttct
     2341 atttatcttt gatttcagtc ttggcaattg tttaaaaaaa aaatctagat ttgttttatt
     2401 aggttcagag tatgtgggga attatagaat ccctctttca tcactttgtg tatgtctttt
     2461 gttaacatat ttgttatgcc ttattctaaa attgagtctc aaactggaat gcctttgaag
     2521 acagatgctt ctatagaggt tctttgacct aaatagttca gcatttgtat ttttattctg
     2581 gtatctaatc agattcctaa tcatagcccg taagaaggaa tgttacttta atattggact
     2641 ttgctcatgt gctcgtgtcc gcattttttt ttttcttaaa atcatagcca tatggtaaat
     2701 tttctatttt gttatggttc tcttttattg atgggcatgc agtgggtgtt acttggaaat
     2761 ggccaatttt tattaaaata tttctggaag aaaatccaaa aaaaaaaaaa aaaaaaaaaa
     2821 aaaaaa
//