LOCUS       BC006355                3107 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens phospholipase C, delta 4, mRNA (cDNA clone MGC:12837
            IMAGE:4124286), complete cds.
ACCESSION   BC006355
VERSION     BC006355.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3107)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 3107)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-APR-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC006355.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 17 Row: g Column: 6
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 34147439.
FEATURES             Location/Qualifiers
     source          1..3107
                     /db_xref="H-InvDB:HIT000032779"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:12837 IMAGE:4124286"
                     /tissue_type="Brain, neuroblastoma"
                     /clone_lib="NIH_MGC_19"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..3107
                     /gene="PLCD4"
                     /gene_synonym="MGC12837"
                     /db_xref="GeneID:84812"
                     /db_xref="HGNC:HGNC:9062"
                     /db_xref="MIM:605939"
     CDS             196..2484
                     /gene="PLCD4"
                     /gene_synonym="MGC12837"
                     /codon_start=1
                     /product="phospholipase C, delta 4"
                     /protein_id="AAH06355.1"
                     /db_xref="GeneID:84812"
                     /db_xref="HGNC:HGNC:9062"
                     /db_xref="MIM:605939"
                     /translation="MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDG
                     MTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNL
                     DLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQ
                     RLLHLMNVEMDQEYAFSLFQAADTSQSGTLEGEEFVQFYKALTKRAEVQELFESFSAD
                     GQKLTLLEFLDFLQEEQKERDCTSELALELIDRYEPSDSGKLRHVLSMDGFLSYLCSK
                     DGDIFNPACLPIYQDMTQPLNHYFICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCV
                     EVDVWDGPSGEPVVYHGHTLTSRILFKDVVATVAQYAFQTSDYPVILSLETHCSWEQQ
                     QTMARHLTEILGEQLLSTTLDGVLPTQLPSPEELRRKILVKGKKLTLEEDLEYEEEEA
                     EPELEESELALESQFETEPEPQEQNLQNKDKKKKSKPILCPALSSLVIYLKSVSFRSF
                     THSKEHYHFYEISSFSETKAKRLIKEAGNEFVQHNTWQLSRVYPSGLRTDSSNYNPQE
                     LWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCGYVLKPDFLRDIQSSFHPEKPISPF
                     KAQTLLIQVISGQQLPKVDKTKEGSIVDPLVKVQIFGVRLDTARQETNYVENNGFNPY
                     WGQTLCFRVLVPELAMLRFVVMDYDWKSRNDFIGQYTLPWTCMQQGYRHIHLLSKDGI
                     SLRPASIFVYICIQEGLEGDES"
BASE COUNT          798 a          796 c          808 g          705 t
ORIGIN      
        1 gccagctgct gtagaagagg ggaggaaaca agccagtgca aggggagcaa aagagaaaag
       61 gagccaggct gggcttcctg atcccacagc atcgcagagc tcgggaggca cagctcacag
      121 acacaggaaa cacaggactg ctattctgct ctcctgccca cggtgatctg gtgccagctg
      181 gtggaacagt gggtgatggc gtccctgctg caagaccagc tgaccactga tcaggacttg
      241 ctgctgatgc aggaaggcat gccgatgcgc aaggtgaggt ccaaaagctg gaagaagcta
      301 agatacttca gacttcagaa tgacggcatg acagtctggc atgcacggca ggccaggggc
      361 agtgccaagc ccagcttctc aatctctgat gtggagacaa tacgtaatgg ccatgattcc
      421 gagttgctgc gtagcctggc agaggagctc cccctggagc agggcttcac cattgtcttc
      481 catggccgcc gctccaacct ggacctgatg gccaacagtg ttgaggaggc ccagatatgg
      541 atgcgagggc tccagctgtt ggtggatctt gtcaccagca tggaccatca ggagcgcctg
      601 gaccaatggc tgagcgattg gtttcaacgt ggagacaaaa atcaggatgg taagatgagt
      661 ttccaagaag ttcagcggtt attgcaccta atgaatgtgg aaatggacca agaatatgcc
      721 ttcagtcttt ttcaggcagc agacacgtcc cagtctggaa ccctggaagg agaagaattc
      781 gtacagttct ataaggcatt gactaaacgt gctgaggtgc aggaactgtt tgaaagtttt
      841 tcagctgatg ggcagaagct gactctgctg gaatttttgg atttcctcca agaggagcag
      901 aaggagagag actgcacctc tgagcttgct ctggaactca ttgaccgcta tgaaccttca
      961 gacagtggca aactgcggca tgtgctgagt atggatggct tcctcagcta cctctgctct
     1021 aaggatggag acatcttcaa cccagcctgc ctccccatct atcaggatat gactcaaccc
     1081 ctgaaccact acttcatctg ctcttctcat aacacctacc tagtggggga ccagctttgc
     1141 ggccagagca gcgtcgaggg atatatacgg gccctgaagc gggggtgccg ctgcgtggag
     1201 gtggatgtat gggatggacc tagcggggaa cctgtcgttt accacggaca caccctgacc
     1261 tcccgcatcc tgttcaaaga tgtcgtggcc acagtagcac agtatgcctt ccagacatca
     1321 gactacccag tcatcttgtc cctggagacc cactgcagct gggagcagca gcagaccatg
     1381 gcccgtcatc tgactgagat cctgggggag cagctgctga gcaccacctt ggatggggtg
     1441 ctgcccactc agctgccctc gcctgaggag cttcggagga agatcctggt gaaggggaag
     1501 aagttaacac ttgaggaaga cctggaatat gaggaagagg aagcagaacc tgagttggaa
     1561 gagtcagaat tggcgctgga gtcccagttt gagactgagc ctgagcccca ggagcagaac
     1621 cttcagaata aggacaaaaa gaagaaatcc aagcccatct tgtgtccagc cctctcttcc
     1681 ctggttatct acttgaagtc tgtctcattc cgcagcttca cacattcaaa ggagcactac
     1741 cacttctacg agatatcatc tttctctgaa accaaggcca agcgcctcat caaggaggct
     1801 ggcaatgagt ttgtgcagca caatacttgg cagttaagcc gtgtgtatcc cagcggcctg
     1861 aggacagact cttccaacta caacccccag gaactctgga atgcaggctg ccagatggtg
     1921 gccatgaata tgcagactgc agggcttgaa atggacatct gtgatgggca tttccgccag
     1981 aatggcggct gtggctatgt gctgaagcca gacttcctgc gtgatatcca gagttctttc
     2041 caccctgaga agcccatcag ccctttcaaa gcccagactc tcttaatcca ggtgatcagc
     2101 ggtcagcaac tccccaaagt ggacaagacc aaagaggggt ccattgtgga tccactggtg
     2161 aaagtgcaga tctttggcgt tcgtctagac acagcacggc aggagaccaa ctatgtggag
     2221 aacaatggtt ttaatccata ctgggggcag acactatgtt tccgggtgct ggtgcctgaa
     2281 cttgccatgc tgcgttttgt ggtaatggat tatgactgga aatcccgaaa tgactttatt
     2341 ggtcagtaca ccctgccttg gacctgcatg caacaaggtt accgccacat tcacctgctg
     2401 tccaaagatg gcatcagcct ccgcccagct tccatctttg tgtatatctg catccaggaa
     2461 ggcctggagg gggatgagtc ctgaggtggg catttcacgg gaagggttgg tatgctggct
     2521 ttagacgggg agaaacatct ggaaggatgc tcgagagaac aaatggaggt ggtgaaaatc
     2581 aagctttgga ttgtgcattc ctaggcacaa aattacctca ttcttcctaa caagcaatct
     2641 gggacctgat tttccacctt ttttctcttt tcttcccttc ctttgttttc ataagccttt
     2701 ggtatctttc ctgccctttt cctttgtgta ctctatactg gagttccctt cttcctcttg
     2761 ctgtaggctc aatcccatac cgacatctac aactaatctt tcccatcaac tctgtgtgaa
     2821 ggcaggttgc aactagaaat tcagaggggc ttggaataga gaaacctaaa gaagcatcat
     2881 cccctccatc cccaacttcc tcaaagccca aagccaaggg aaggataaat caaggctcaa
     2941 ggcttcccca gcaaagatta gggaaagaga cttgacccca ggactgtact acgactctta
     3001 agagaacact gcacagcact caaagtcccc cactggactg cttcctcctt agccccactg
     3061 gtataaatac atctctctcc aatttggcaa aaaaaaaaaa aaaaaaa
//