LOCUS       BC005016                1205 bp    mRNA    linear   HUM 12-JUL-2001
DEFINITION  Homo sapiens, clone IMAGE:3636175, mRNA, partial cds.
ACCESSION   BC005016
VERSION     BC005016.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1205)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-MAR-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
            Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
            Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
            Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
            Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
            Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
            Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
            George Yang, Scott Zuyderduyn, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 13 Row: f Column: 4
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis.
FEATURES             Location/Qualifiers
     source          1..1205
                     /db_xref="H-InvDB:HIT000086434"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3636175"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_21"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     CDS             <1..977
                     /codon_start=3
                     /product="Unknown (protein for IMAGE:3636175)"
                     /protein_id="AAH05016.1"
                     /translation="PTTEGVKRRVKSPGSGHVKQKAVKRPASMYSTGKRKENPIEDDL
                     IFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQIFSNDGQFKSRFGIRGRSP
                     GQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSVDRNGH
                     IIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIITDFHNHSV
                     KVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFLS
                     YINTSADPLYGPQGLALTSDGHVVVADSGNHCLILIYSRHLFFYESKC"
BASE COUNT          377 a          227 c          285 g          316 t
ORIGIN      
        1 ctcccaccac agaaggcgtg aagaggcgcg ttaagtcccc ggggagcggc cacgtcaagc
       61 agaaagctgt gaaaagaccc gcaagcatgt acagcactgg aaaacgaaaa gagaatccca
      121 tcgaagacga tttgatcttt cgagtgggta ccaaaggaag aaataaagga gagtttacaa
      181 atcttcaggg ggtagctgca tctacaaatg gaaagatatt aattgcagac agtaacaacc
      241 aatgtgtgca gatattttcc aatgatggcc agttcaaaag tcgttttggc atacggggac
      301 gctctccggg gcagctgcag cggcccacag gagtggctgt acatcccagt ggggacataa
      361 tcattgccga ttatgataat aaatgggtca gcattttctc ctccgatggg aaatttaaga
      421 caaaaattgg atcaggaaag ctgatgggac ccaaaggagt ttctgtggac cgcaatgggc
      481 acattattgt tgtggacaac aaggcgtgct gcgtgtttat cttccagcca aacgggaaaa
      541 tagtcaccag gtttggtagc cgaggaaatg gggacaggca gtttgcaggt ccccattttg
      601 cagctgtaaa tagcaataat gagattatta ttacagattt ccataatcat tctgtcaagg
      661 tgtttaatca ggaaggagaa ttcatgttga agtttggctc aaatggagaa ggaaatgggc
      721 agtttaatgc tccaacaggt gtagcagtgg attcaaatgg aaacatcatt gtggccgact
      781 ggggaaacag caggatccag gtttttgatg ggagtggatc atttttgtcc tacattaaca
      841 catctgctga cccactctat ggcccccaag gcctggccct aacttcagat ggtcatgttg
      901 tggttgcaga ctctggaaat cactgtttga tactgatata ttctcgtcat ttgttctttt
      961 atgaatcaaa atgttgactg cctatttaaa gaaaagaatg aacgctgtgc atcaaagtgt
     1021 ttgtatgttc gtagctacat acgtaccaca gtattttgga tgctttagtc tacaatgaaa
     1081 ctttcaatta attctgtctt gaaacatagg agaaacagga ttcatgtgta tctctttacc
     1141 atgcacaaaa tctcaaatca ttataataaa gcttgttttc tccaaaaaaa aaaaaaaaaa
     1201 aaaaa
//