LOCUS       BC004956                1922 bp    mRNA    linear   HUM 12-JUL-2001
DEFINITION  Homo sapiens, clone IMAGE:3625550, mRNA, partial cds.
ACCESSION   BC004956
VERSION     BC004956.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1922)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Steven Jones, Jennifer Asano, Ian Bosdet, Yaron Butterfield,
            Susanna Chan, Readman Chiu, Chris Fjell, Erin Garland, Ran Guin,
            Letticia Hsiao, Martin Krzywinski, Reta Kutsche, Oliver Lee, Soo
            Sen Lee, Victor Ling, Carrie Mathewson, Candice McLeavy, Steven
            Ness, Pawan Pandoh, Anna-Liisa Prabhu, Parvaneh Saeedi, Jacqueline
            Schein, Duane Smailus, Michael Smith, Lorraine Spence, Jeff Stott,
            Michael Thorne, Miranada Tsai, Natasja van den Bosch, Jill Vardy,
            George Yang, Scott Zuyderduyn, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 13 Row: m Column: 4
            This clone was selected for full length sequencing because it
            passed the following selection criteria: Hexamer frequency ORF
            analysis.
FEATURES             Location/Qualifiers
     source          1..1922
                     /db_xref="H-InvDB:HIT000086425"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3625550"
                     /tissue_type="Uterus, endometrium adenocarcinoma"
                     /clone_lib="NIH_MGC_44"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     CDS             <1..1088
                     /codon_start=3
                     /product="Unknown (protein for IMAGE:3625550)"
                     /protein_id="AAH04956.1"
                     /translation="AICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDRDELDREEE
                     EEDGEEEEVEAVGAGAGWDTPMRDEDYEGDMEEEVEEEEEGVFWTSGMSRSSWDNMDY
                     VWEEEDEEEDLDYYLGDMEEEDLRGEDEEDEEEVLEEVEEEDLDPVTPLPPPPAPRRC
                     FTCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPTPGRGSRVTDQGICPKHQEALKLFC
                     EVDEEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEE
                     RRVTELKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAASRLA
                     EQAAQLSRLLAEAQERSQQGGLRLLQV"
BASE COUNT          430 a          512 c          622 g          358 t
ORIGIN      
        1 gcgccatctg cctcgattac ttcacggacc ccgtgtccat cggctgcggg cacaacttct
       61 gccgagtttg tgtaacccag ttgtggggtg gggaggatga ggaggacaga gatgagttag
      121 atcgggagga ggaggaggag gacggagagg aggaggaagt ggaggctgtg ggggctggcg
      181 cggggtggga cacccccatg cgggatgaag actacgaggg tgacatggag gaggaggtcg
      241 aggaggaaga agagggtgtg ttctggacca gtggcatgag caggtccagc tgggacaaca
      301 tggactatgt gtgggaggag gaggacgagg aggaagacct ggactactac ttgggggaca
      361 tggaggagga ggacctgagg ggggaggatg aggaggacga ggaggaagtg ctggaggagg
      421 ttgaggaaga ggatctagac cccgtcaccc cactgccccc gcctccagcc cctcggaggt
      481 gcttcacatg ccctcagtgc cgaaagagct ttcctcggcg gagcttccgc cccaacctgc
      541 agctggccaa tatggtccag gtgattcggc agatgcaccc aacccctggt cgagggagcc
      601 gcgtgaccga tcagggcatc tgtcccaaac accaagaagc cctgaagctc ttctgcgagg
      661 tagacgaaga ggccatctgt gtggtgtgcc gagaatccag gagccacaaa cagcacagcg
      721 tggtgccatt ggaggaggtg gtgcaggagt acaaggccaa actgcagggg cacgtggaac
      781 cactgaggaa gcacctggag gcagtgcaga agatgaaagc caaggaggag aggcgagtga
      841 cagaactgaa gagccagatg aagtcagagc tggcagcggt ggcctcggag tttgggcgac
      901 tgacacggtt tctggctgaa gagcaggcag ggctggaacg gcgtctcaga gagatgcatg
      961 aagcccagct ggggcgtgcg ggagccgcgg ctagtcgcct tgcagaacag gccgcccagc
     1021 tcagccgcct gctggcagag gcccaggagc ggagccagca ggggggtctc cggctgctcc
     1081 aggtgtgaag aggtacagct gcagccccca gaggtctggt cccctgaccc gtgccaaccc
     1141 catagccatg acttcctgac agatgccatc gtgaggaaaa tgagccggat gttctgtcag
     1201 gctgcgagag tggacctgac gctggaccct gacacggctc acccggccct gatgctgtcc
     1261 cctgaccgcc ggggggtccg cctggcagag cggcggcagg aggttgctga ccatcccaag
     1321 cgcttctcgg ccgactgctg cgtactgggg gcccagggct tccgctccgg ccggcactac
     1381 tgggaggagc ctaaagaacc ctcctggcct ccagctcagc cttctctcac ctactatgtc
     1441 tgtccaacag accggccaga atttagcttc acttgagaga gatctggaat ggtcgccatg
     1501 attgaaacca cgcaccatta catcatcatt acattaatta catcaacata aattatttct
     1561 tcccccttcc cttttccagc actcaaccaa ggagcaaagc tcatcccacc ccacacccct
     1621 cccaggtctg ctcactgcca ggctcctctc ccctttgttc agtggagctg gcttttctcc
     1681 cagccccttt ccatgccttt cactccattt ggcaagctct gagggggagc ctggggacgg
     1741 gtttgggtcc ccaggaggag agccttgggt ataatctatt tttctaggag cctcttgcct
     1801 tgtcacttgc agctttcgcc ctctgctttg atggctgagg tgaactcatg ttctttggga
     1861 aaagggaagg cgtgctgtgg aaataaaatg tttatttgct tctcaaaaaa aaaaaaaaaa
     1921 aa
//