LOCUS       BC004932                1641 bp    mRNA    linear   HUM 09-JUN-2008
DEFINITION  Homo sapiens transmembrane protein 204, mRNA (cDNA clone MGC:10688
            IMAGE:3622114), complete cds.
ACCESSION   BC004932
VERSION     BC004932.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1641)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1641)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-MAR-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 13 Row: d Column: 21
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 13375800.
FEATURES             Location/Qualifiers
     source          1..1641
                     /db_xref="H-InvDB:HIT000032095"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:10688 IMAGE:3622114"
                     /tissue_type="Pancreas, adenocarcinoma"
                     /clone_lib="NIH_MGC_39"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1641
                     /gene="TMEM204"
                     /gene_synonym="CLP24"
                     /db_xref="GeneID:79652"
                     /db_xref="HGNC:HGNC:14158"
                     /db_xref="MIM:611002"
     CDS             399..1079
                     /gene="TMEM204"
                     /gene_synonym="CLP24"
                     /codon_start=1
                     /product="TMEM204 protein"
                     /protein_id="AAH04932.1"
                     /db_xref="GeneID:79652"
                     /db_xref="HGNC:HGNC:14158"
                     /db_xref="MIM:611002"
                     /translation="MTVQRLVAAAVLVALVSLILNNVAAFTSNWVCQTLEDGRRRSVG
                     LWRSCWLVDRTRGGPSPGARAGQVDAHDCEALGWGSEAAGFQESRGTVKLQFDMMRAC
                     NLVATAALTAGQLTFLLGLVGLPLLSPDAPCWEEAMAAAFQLASFVLVIGLVTFYRIG
                     PYTNLSWSCYLNIGACLLATLAAAMLIWNILHKREDCMAPRVIVISRSLTARFRRGLD
                     NDYVESPC"
BASE COUNT          306 a          512 c          499 g          324 t
ORIGIN      
        1 ccgctctgag gactggaggg accagccgcc cacagagccc cgagcccgtg gtcccggcga
       61 gaagaggcac gcgcggcaca ggccggcctc cgcttcccgg gaagacggcg cactcctggc
      121 cctgggttct tgctgctgcc caccctctgc tccctgggat gggccccgag gcgagcagct
      181 tcagcacagg cctggccctg ctccaggtgc aggaaggagg ataaggccgg gccgagaggc
      241 ggcacacctg gaccatccca tgggcctccg cccgcgccgc cccgaggatg agtggtgatg
      301 tcctctagcc acccctagca gcgtcggctc tccctggacg tgcggccgcg gactgggact
      361 tggctttctc cggataagcg gcggcaccgg cgtcagcgat gaccgtgcag agactcgtgg
      421 ccgcggccgt gctggtggcc ctggtctcac tcatcctcaa caacgtggcg gccttcacct
      481 ccaactgggt gtgccagacg ctggaggatg ggcgcaggcg cagcgtgggg ctgtggaggt
      541 cctgctggct ggtggacagg acccggggag ggccgagccc tggggccaga gccggccagg
      601 tggacgcaca tgactgtgag gcgctgggct ggggctccga ggcagccggc ttccaggagt
      661 cccgaggcac cgtcaaactg cagttcgaca tgatgcgcgc ctgcaacctg gtggccacgg
      721 ccgcgctcac cgcaggccag ctcaccttcc tcctggggct ggtgggcctg cccctgctgt
      781 cacccgacgc cccgtgctgg gaggaggcca tggccgctgc attccaactg gcgagttttg
      841 tcctggtcat cgggctcgtg actttctaca gaattggccc atacaccaac ctgtcctggt
      901 cctgctacct gaacattggc gcctgccttc tggccacgct ggcggcagcc atgctcatct
      961 ggaacattct ccacaagagg gaggactgca tggccccccg ggtgattgtc atcagccgct
     1021 ccctgacagc gcgctttcgc cgtgggctgg acaatgacta cgtggagtca ccatgctgag
     1081 tcgcccttct cagcgctcca tcgacgcaca cctgctatcg tggaacagcc tagaaaccaa
     1141 gggactccac caccaagtca cttcccctgc tcgtgcagag gcacgggatg agtctgggtg
     1201 acctctgcgc catgagtgcg agacacgtgt gcgtttactg ttatgtcggt catatgtctg
     1261 tacgtgtcgt gggccaacct cgttctgcct ccagctttcc tggttagcgc aacgcggctc
     1321 cacgaccaca cgcacttcag ggtggaagct ggaagctgag acacaggtta ggtggcgcga
     1381 ggctgccctg cgctccgctt tgctttggga ttaatttatt ctgcatctgc tgagaggggc
     1441 accccagcca tatcttacac tttggtaaag cagaaaacca ggaaaatttt cttaaaatat
     1501 ccacaatatt ccttgagtga gtcagaatct atagccggtt agtgatggtt tcagacagaa
     1561 tcgtgttcgt gtctgttttg ctcgattcct ttcctaagtt aaataaatgc aagcctctga
     1621 aaaaaaaaaa aaaaaaaaaa a
//