LOCUS       BC003567                1623 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens epoxide hydrolase 1, microsomal (xenobiotic), mRNA
            (cDNA clone MGC:2074 IMAGE:3547085), complete cds.
ACCESSION   BC003567
VERSION     BC003567.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1623)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1623)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-FEB-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 8 Row: j Column: 22
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 4557560.
FEATURES             Location/Qualifiers
     source          1..1623
                     /db_xref="H-InvDB:HIT000031605"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:2074 IMAGE:3547085"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_20"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1623
                     /gene="EPHX1"
                     /gene_synonym="EPOX"
                     /gene_synonym="MEH"
                     /db_xref="GeneID:2052"
                     /db_xref="HGNC:HGNC:3401"
                     /db_xref="MIM:132810"
     CDS             26..1393
                     /gene="EPHX1"
                     /gene_synonym="EPOX"
                     /gene_synonym="MEH"
                     /codon_start=1
                     /product="epoxide hydrolase 1, microsomal (xenobiotic)"
                     /protein_id="AAH03567.1"
                     /db_xref="GeneID:2052"
                     /db_xref="HGNC:HGNC:3401"
                     /db_xref="MIM:132810"
                     /translation="MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAARE
                     DDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYGFNSNYLKKVISYWRNEFD
                     WKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHTPKPLLMVHGWPGSFYEFYKI
                     IPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQ
                     EFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTE
                     RDVELLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTN
                     TEFRYLEDGGLERKFSLDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKV
                     YVPTGFSAFPFELLHTPEKWVRFKYPKLISYSYMVRGGHFAAFEEPELLAQDIRKFLS
                     VLERQ"
BASE COUNT          368 a          486 c          409 g          360 t
ORIGIN      
        1 ggagcctgcg agccgagacc gagccatgtg gctagaaatc ctcctcactt cagtgctggg
       61 ctttgccatc tactggttca tctcccggga caaagaggaa actttgccac ttgaagatgg
      121 gtggtggggg ccaggcacga ggtccgcagc cagggaggac gacagcatcc gccctttcaa
      181 ggtggaaacg tcagatgagg agatccacga cttacaccag aggatcgata agttccgttt
      241 caccccacct ttggaggaca gctgcttcca ctatggcttc aactccaact acctgaagaa
      301 agtcatctcc tactggcgga atgaatttga ctggaagaag caggtggaga ttctcaacag
      361 ataccctcac ttcaagacta agattgaagg gctggacatc cacttcatcc acgtgaagcc
      421 cccccagctg cccgcaggcc ataccccgaa gcccttgctg atggtgcacg gctggcccgg
      481 ctctttctac gagttttata agatcatccc actcctgact gaccccaaga accatggcct
      541 gagcgatgag cacgtttttg aagtcatctg cccttccatc cctggctatg gcttctcaga
      601 ggcatcctcc aagaaggggt tcaactcggt ggccaccgcc aggatctttt acaagctgat
      661 gctgcggctg ggcttccagg aattctacat tcaaggaggg gactgggggt ccctgatctg
      721 cactaatatg gcccagctgg tgcccagcca cgtgaaaggc ctgcacttga acatggcttt
      781 ggttttaagc aacttctcta ccctgaccct cctcctggga cagcgtttcg ggaggtttct
      841 tggcctcact gagagggatg tggagctgct gtaccccgtc aaggagaagg tattctacag
      901 cctgatgagg gagagcggct acatgcacat ccagtgcacc aagcctgaca ccgtaggctc
      961 tgctctgaat gactctcctg tgggtctggc tgcctatatt ctagagaagt tttccacctg
     1021 gaccaatacg gaattccgat acctggagga tggaggcctg gaaaggaagt tctccctgga
     1081 cgacctgctg accaacgtca tgctctactg gacaacaggc accatcatct cctcccagcg
     1141 cttctacaag gagaacctgg gacagggctg gatgacccag aagcatgagc ggatgaaggt
     1201 ctatgtgccc actggcttct ctgccttccc ttttgagcta ttgcacacgc ctgaaaagtg
     1261 ggtgaggttc aagtacccaa agctcatctc ctattcctac atggttcgtg ggggccactt
     1321 tgcggccttt gaggagccgg agctgctcgc ccaggacatc cgcaagttcc tgtcggtgct
     1381 ggagcggcaa tgacccaccc ctctcccccc gcctgccacc tccccccaca agtgccctcc
     1441 aggcttttct tggggaagat accccttttc tgaggaatga gtttgcctcc gtcccctgcc
     1501 catgctggga gcccacgctc accccctcac ccctccaagc tcactcccca acccccaact
     1561 ccgtgtggta agcaacatgg ctttgatgat aaacgacttt actctaaaaa aaaaaaaaaa
     1621 aaa
//