LOCUS       BC002881                2405 bp    mRNA    linear   HUM 09-DEC-2005
DEFINITION  Homo sapiens chromosome 15 open reading frame 42, mRNA (cDNA clone
            IMAGE:3940845), partial cds.
ACCESSION   BC002881
VERSION     BC002881.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2405)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2405)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Dec 9, 2003 this sequence version replaced BC002881.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 15 Row: g Column: 5.
FEATURES             Location/Qualifiers
     source          1..2405
                     /db_xref="H-InvDB:HIT000086176"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3940845"
                     /tissue_type="Lung, small cell carcinoma"
                     /clone_lib="NIH_MGC_7"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            <1..2405
                     /gene="C15orf42"
                     /gene_synonym="FLJ41618"
                     /gene_synonym="MGC45866"
                     /db_xref="GeneID:90381"
                     /db_xref="HGNC:HGNC:28704"
                     /db_xref="IMGT/GENE-DB:28704"
                     /db_xref="MIM:28704"
     CDS             <1..644
                     /gene="C15orf42"
                     /gene_synonym="FLJ41618"
                     /gene_synonym="MGC45866"
                     /codon_start=3
                     /product="C15orf42 protein"
                     /protein_id="AAH02881.2"
                     /db_xref="GeneID:90381"
                     /db_xref="HGNC:HGNC:28704"
                     /db_xref="IMGT/GENE-DB:28704"
                     /db_xref="MIM:28704"
                     /translation="SSSGRGEVGADLPGSLSLLESEGKDHGLELSIHRTPILEDFELE
                     GVCQLPDQSPPRNSMPKAEEASSWGQFGLSSRKRVLLAKEEADRGAKRICDLREDSEV
                     SKSKEGSPSWSAWQLPSTGDEEVFVSGSTPPPSCAVRSCLSASALQALTQSPLLFQGK
                     TPSSQSKDPRDEDVDVLPSTVEDSPFSRAFSRRRPISRTYTRKKLMGTWLEDL"
BASE COUNT          605 a          680 c          629 g          491 t
ORIGIN      
        1 gctcctcttc cgggaggggc gaggtcggtg cagaccttcc tgggagcctg tcactgcttg
       61 agtcagaggg caaggaccac ggccttgaac tcagcatcca caggacgccc atcttggagg
      121 attttgagct cgagggagtg tgccagctcc cagaccagtc gcctcccagg aacagcatgc
      181 ctaaggccga ggaagcctct tcctggggac agtttgggtt gagttccagg aagagagtcc
      241 tgttggccaa ggaagaagct gaccgtggag ccaaaaggat ctgtgacctg agagaagatt
      301 cagaagttag taagagtaaa gaggggtctc caagttggag tgcatggcag ctaccctcca
      361 cgggagacga agaggtgttt gtttccggct ccaccccacc tcccagctgt gccgtgcgga
      421 gctgcctctc tgccagtgcc ctccaggctc tgacccagtc tccgctgctg ttccagggga
      481 aaacaccttc ctctcagagc aaagacccca gagatgagga tgtggatgtt cttccctcca
      541 ctgtagaaga ctctcctttc agtcgcgctt tctccaggag gcgccccatc agcagaactt
      601 atacacggaa gaagctcatg ggaacctggc tggaggactt atagccacaa acattactga
      661 gcccaaaaga tcaaggagtc agccaggacc ctgtggacat aaagaagttg gatgcctggt
      721 cccaagcctc ttttgccatg ggtcagctgg cggtccatct ccaggcgctg ccgctccagg
      781 gccacctcca gccagtacac cagcctctgc tgctcctcca gctgcatctc cagttccgag
      841 aaggcaatct gctgctggtg ctgctcctct cggagcgtca ccacctgtcc caagacccag
      901 ccaggctcag ccctcatcat gacccctctt catccagcta atcctcaatc acagacacag
      961 tattggcaca cttgccacca cggcactaag aaatcaccag ggtcttccct gctgagccaa
     1021 gactcagcct cagacacctc agcagtgctc tagttatctt ccaacgatca gagctggctc
     1081 tcaccttatc tgctatctct gccacaaacc ctttcctagc cacacactat ggagctgggc
     1141 agagcgtcaa gttgtgggat ttcatctaga ccaacctcag cactatggac atctgggacc
     1201 agataattct tggttgtggg ggcctgtcct gtgtgttata ggatgtttag taacatccct
     1261 ggcctccacc cccaccactg tgacaaccaa aagtatctcc agccatggcc aaatgtcaca
     1321 aaagggcaaa aacttcccct actgagagct actattgtgg ccatggacca ccctgaggtt
     1381 agccaatcag agcagaagtg gggggcgggt aggaaactgg gtcttagttt cacaagtaaa
     1441 ataggcttta aggtcaggcg gccctgcaga tgagttggtc ctgattctgt cccccagtct
     1501 gggaggaaac gggatatccg ctggagcagc tgccatgaga cacctcccca cacgtgccgc
     1561 tgaggaggag ctggggggcc atgggctgct ggcccacctt gtcaaaatac ttgcagagga
     1621 gggctctggt ctctgaggat gagaggtagc tgagcttggc catgaggttc atctcgcact
     1681 gggacagcaa cgaggctgag gcccgaagca cccgctggcg gcatgtgatg gcctcattct
     1741 tatactcaat ggcagcatcc agggcctcga tggcctcatc caactggaac agcgtccgct
     1801 cctcctgcag agacaggggc acgcgtggag gaacagcacc cactgcctga atgctgaagt
     1861 cctgggcaga catgcaacag ccaacacgta gccacaactg ggccttaagg gtcccctcgt
     1921 cccaagggcc aagtcagcgc atcgagagag gtgccccctg ctcactgtca cagccccaac
     1981 cccagggtga gctgggggca ctgctcagag gtggcctgct caactgcaag cctctgtgaa
     2041 tgatctacat tcaggaagtt cagagcaccc taaccaaaca aaaggcatgg ttgggacagc
     2101 cacggaggca ccacggtgtc tgctgggtaa gcttctacag atggggatac gttctaagaa
     2161 atgcatcatt aggcgttttc gacgtcgtgc aaacatcaga atatactcac acaaacctag
     2221 atggtatagc ccaccacaca cctaggctac aagcctggac agcatgtgac tgtactgaat
     2281 actgtaggca gttgttaacc atggtgagta tttgtgtatc taaacataga aaacgcacag
     2341 taaaaatgcg gtattataat tttctgggaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa
     2401 aaaaa
//