LOCUS       BC002819                 996 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens transmembrane protein 11, mRNA (cDNA clone MGC:3676
            IMAGE:3636199), complete cds.
ACCESSION   BC002819
VERSION     BC002819.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 996)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 996)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Oct 31, 2003 this sequence version replaced BC002819.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 12 Row: f Column: 12
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 4505900.
FEATURES             Location/Qualifiers
     source          1..996
                     /db_xref="H-InvDB:HIT000031213"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:3676 IMAGE:3636199"
                     /tissue_type="Placenta, choriocarcinoma"
                     /clone_lib="NIH_MGC_21"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..996
                     /gene="TMEM11"
                     /gene_synonym="PM1"
                     /gene_synonym="PMI"
                     /db_xref="GeneID:8834"
                     /db_xref="HGNC:HGNC:16823"
     CDS             32..610
                     /gene="TMEM11"
                     /gene_synonym="PM1"
                     /gene_synonym="PMI"
                     /codon_start=1
                     /product="transmembrane protein 11"
                     /protein_id="AAH02819.1"
                     /db_xref="GeneID:8834"
                     /db_xref="HGNC:HGNC:16823"
                     /translation="MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQ
                     FEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLD
                     YSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLV
                     RKDDLHRKRLHNTIALAALVYCVKKIYELYAV"
BASE COUNT          246 a          255 c          283 g          212 t
ORIGIN      
        1 gcgagacgtt ggcaagcaga gtgtctccaa gatggccgct tggggaagga ggcgtcttgg
       61 cccgggcagc agtggcggca gcgcccgaga gagggtgagc ttgtcggcca cagactgcta
      121 cattgtgcat gagatctaca atggggagaa tgcccaagac cagtttgagt acgagctgga
      181 gcaggccctg gaagcccagt acaagtacat tgtgattgag cccactcgca ttggcgacga
      241 gacagcccgc tggatcaccg tgggcaactg cctgcacaag acggccgtgc tggcgggcac
      301 cgcctgcctc ttcaccccgt tggcgctgcc cttagattat tcccactaca tttccctgcc
      361 cgctggtgtg ctgagcctgg cctgctgcac cctctatggg atctcctggc agtttgaccc
      421 ttgctgcaag taccaagtgg agtacgacgc ctataaactg tcgcgcctgc ctctgcacac
      481 actcacctcc tccaccccgg tggtgctggt ccggaaggac gacctgcaca gaaagagact
      541 gcacaacacg atagcactgg ccgccctggt gtactgtgta aagaagattt acgaactcta
      601 tgccgtatga tttcagtaga acagggagcg aagcaaaacc acccggccca caagagacaa
      661 cagagtattc agatcgccac actctgtgag gcagcagagc ctgggcaggt gtttggctta
      721 gtatttgtta tttttaaaaa ataacagatc acgggtgtac ccagggtttt tcagctcatt
      781 acactaagat gtggatttcc ataacccaag aggggggtct gaggctgtgg aagtccgact
      841 gggcagtgga atgctgatgg aggcagacgc tgccgagggg gtgtggacgt gctttggggg
      901 aggtctttaa gtctattgtt taactgtacc atccagagcc caccagaagc tattgatcat
      961 taaaattatg agaatttcaa aaaaaaaaaa aaaaaa
//