LOCUS       BC002679                2407 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens fatty acid 2-hydroxylase, mRNA (cDNA clone MGC:4282
            IMAGE:3610614), complete cds.
ACCESSION   BC002679
VERSION     BC002679.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2407)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2407)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced gi:12803686.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 12 Row: k Column: 19.
FEATURES             Location/Qualifiers
     source          1..2407
                     /db_xref="H-InvDB:HIT000031091"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:4282 IMAGE:3610614"
                     /tissue_type="Pancreas, adenocarcinoma"
                     /clone_lib="NIH_MGC_39"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2407
                     /gene="FA2H"
                     /gene_synonym="FAAH"
                     /gene_synonym="FLJ25287"
                     /db_xref="GeneID:79152"
                     /db_xref="HGNC:HGNC:21197"
     CDS             43..1161
                     /gene="FA2H"
                     /gene_synonym="FAAH"
                     /gene_synonym="FLJ25287"
                     /codon_start=1
                     /product="fatty acid 2-hydroxylase"
                     /protein_id="AAH02679.2"
                     /db_xref="GI:52632409"
                     /db_xref="GeneID:79152"
                     /db_xref="HGNC:HGNC:21197"
                     /translation="MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHP
                     GGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEE
                     TQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDL
                     IEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGL
                     FMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVP
                     ASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKA
                     HHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ"
BASE COUNT          477 a          795 c          630 g          505 t
ORIGIN      
        1 agcagacgcc gggctgcgcg ctgggagctg cggtctccgg ccatggcccc cgctccgccc
       61 cccgccgcct ccttctcgcc ctccgaggtc cagcggcgcc tggcggccgg cgcgtgctgg
      121 gtccgccgcg gggcccgcct ctacgacctc tccagcttcg tgcggcacca cccggggggc
      181 gagcagctgc tgcgggccag ggcgggccag gacatcagcg ccgacctgga cgggccgccg
      241 cacaggcact cggccaacgc gcgccgctgg ctggagcagt actacgtggg agagctccgc
      301 ggggagcagc agggctccat ggagaacgag cctgtagccc ttgaggaaac tcagaagaca
      361 gatcctgcta tggaaccacg gttcaaagtg gtggattggg acaaggacct ggtggactgg
      421 cgaaagcctc tcctgtggca ggtgggccac ttgggagaga agtacgatga gtgggttcac
      481 cagccggtga ccaggcccat ccgcctcttc cactcagacc tcattgaggg cctctctaag
      541 actgtctggt acagtgtccc catcatctgg gtgcccctgg tgctgtatct cagctggtcc
      601 tactaccgaa cctttgccca gggcaacgtc cgactcttca cgtcatttac aacagagtac
      661 acggtggcag tgcccaagtc catgttcccc gggctcttca tgctggggac attcctctgg
      721 agcctcatcg agtacctcat ccaccgcttc ctgttccaca tgaagccccc cagcgacagc
      781 tattacctca tcatgctgca cttcgtcatg cacggccagc accacaaggc acccttcgac
      841 ggctcccgcc tggtcttccc ccctgtgcca gcctccctgg tgatcggcgt cttctacttg
      901 tgcatgcagc tcatcctgcc tgaggcagta gggggcactg tgtttgcggg gggcctcctg
      961 ggctacgtcc tctatgacat gacccattac tacctgcact ttggctcgcc gcacaagggc
     1021 tcctacctgt acagcctgaa ggcccaccac gtcaagcacc actttgcaca tcagaagtca
     1081 ggatttggta tcagcactaa attgtgggat tactgtttcc acaccctcac tccagagaaa
     1141 ccccacctga agacgcagtg acaactccca ccccctccgt cctgccctca gcccggccct
     1201 ggccccttcc cgacccccac ccgccattca gaccccatta agaaggttgg cttggccagg
     1261 caggatgggc tgtgtccggc cctgcagcct agtggaaggt gctgaggggg ccctgaggca
     1321 ggaccgccct cctgacccct ggtaggaggg tcacatccac ttggtggcca ggtggccctt
     1381 ggtgacccac ttcttcctgg agcgtccctg cctagagctc agcccacagg actgcttcag
     1441 gccgtggcca caggtagcag ccgcaagggg aaatgaagaa aactgagccc tcgtggccac
     1501 ctgtgtcacc cttgtgcctt agcctcatgg gctgcctagg agctgcctgc acggcacagc
     1561 tcgctttcac agtcagaagt gggtctgtgg gatctgtggt ccctgtcctc cctgctgtcc
     1621 cttctgggga ggctttggtg gctctgaggt ggacaaagag ctctcgcaag aagagacagc
     1681 gtgatgcctc ccacagtcca ccccagaccc tggggcagcc cctctggccc tgccagctgc
     1741 ctgcgtcgtt gggcccaggg tggctggcag gagtcccagc tgcttgcttt aggacctcgc
     1801 agcttttctt gccgtccctc ccctgcctcc agaatcacag cccttctccc caagggaggc
     1861 tgaggaggct tctccaccag tggcagcccc accccgtccc tggccattct tggcctccac
     1921 cccgctcagg cccctactcg ggcgctccca gaaggagcca cctctcagtg cctcacctcc
     1981 ccctgcctcc cagcctccgc agatgaggtt cctgcccctt cctcctcgta accaaaaccc
     2041 tcactgctcc caggacggtc ttatttataa accagataca tgttcttagt ctggtcccag
     2101 accaaggagc tggtcagacg gccctttcta atcctacatg ttgagcttat gtaaaaaatg
     2161 ttgtttcctc ctgtttttgg ttcctttctt acccacaaac cattactact tgaaacttaa
     2221 aaaactcgcc aagtgtaaag gctaaagaga agcagtttga cggaccttgt gatttgtact
     2281 gtttgctgcg gagctattta aagattttgg aataaatata caaaactacg gttgtgaaat
     2341 aaaaacttaa attgtatatt ttgaaaaata aaacactgaa aagaaaccaa aaaaaaaaaa
     2401 aaaaaaa
//