LOCUS       BC002501                1321 bp    mRNA    linear   HUM 12-FEB-2004
DEFINITION  Homo sapiens thyroid hormone receptor associated protein 3, mRNA
            (cDNA clone IMAGE:3050423), partial cds.
ACCESSION   BC002501
VERSION     BC002501.2
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1321)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1321)
  AUTHORS   Strausberg,R.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Cancer Genomics Office, National Cancer
            Institute, 31 Center Drive, Room 11A03, Bethesda, MD 20892-2590,
            USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Aug 19, 2003 this sequence version replaced BC002501.1.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 4 Row: g Column: 5
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 4827039.
FEATURES             Location/Qualifiers
     source          1..1321
                     /db_xref="H-InvDB:HIT000086136"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="IMAGE:3050423"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_20"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..>1321
                     /gene="THRAP3"
                     /gene_synonym="TRAP150"
                     /db_xref="GeneID:9967"
                     /db_xref="MIM:603809"
     CDS             196..>1321
                     /gene="THRAP3"
                     /gene_synonym="TRAP150"
                     /codon_start=1
                     /product="THRAP3 protein"
                     /protein_id="AAH02501.1"
                     /db_xref="GeneID:9967"
                     /db_xref="MIM:603809"
                     /translation="MSKTNKSKSGSRSSRSRSASRSRSRSFSKSRSRSRSLSRSRKRR
                     LSSRSRSRSYSPAHNRERNHPRVYQNRDFRGHNRGYRRPYYFRGRNRGFYPWGQYNRG
                     GYGNYRSNWQNYRQAYSPRRGRSRSRSPKRRSPSPRSRSHSRNSDKSSSDRSRRSSSS
                     RSSSNHSRVESSKRKSAKEKKSSSKDSRPSQAAGDNQGDEVKEQTFSGGTSQDTKASE
                     SSKPWPDATYGTGSASRASAVSELSPRERSPALKSPLQSVVVRRRSPRPSPVPKPSPP
                     LSSTSQMGSTLPSGAGYQSGTHQGQFDHGSGSLSPSKKSPVGKSPPSTGSTYGSSQKE
                     ESAASGGAAYTKRYLEEQKTENGKDKEQKQTNTDKEKKKKK"
BASE COUNT          361 a          339 c          333 g          288 t
ORIGIN      
        1 gcgaggttcg ggctggttgt tccgttgcga gctgcagctg cgatctctgt ggtaggccca
       61 gaagtgtatg ctgacttgta aagtgaagaa gccagtggtg ctgcgggtgt tcttttgggg
      121 tagtgtctgg gatccagtac gagttgaatc attgttcaaa taaggtgtaa ttgaaaagtg
      181 atcctctctt cagagatgtc aaaaacaaac aaatccaagt ctggatctcg ctcttctcgc
      241 tcaagatctg catcaagatc tcgttctcgt tcattttcga agtctcggtc ccgaagccga
      301 tctctctctc gttcaaggaa gcgcaggctg agttctaggt ctcgttccag atcatattct
      361 ccagctcata acagagaaag aaaccaccca agagtatatc agaatcggga tttccgaggt
      421 cacaacagag gctatagaag gccctattat ttccgtgggc gtaacagagg cttttatcca
      481 tggggccaat ataaccgagg aggctatgga aactaccgct caaattggca gaattaccgg
      541 caagcataca gtcctcgtcg aggccgttca agatcccggt ccccaaagag aaggtcccct
      601 tcaccaaggt ccaggagcca ttctagaaac tctgataagt cgtcttctga ccggtcaagg
      661 cgctcctcat cctcccgttc ttcctccaac catagccgag ttgaatcttc taagcgcaag
      721 tctgcaaagg agaaaaagtc ctcttctaag gatagccggc catctcaggc tgccggggat
      781 aaccagggag atgaggtcaa ggagcagaca ttctctggag gcacctctca agatacaaaa
      841 gcatctgaga gctcgaagcc atggccagat gccacctacg gcactggttc tgcatcacgg
      901 gcctcagcag tttctgagct gagtcctcgg gagcgaagcc cagctctcaa aagccccctc
      961 cagtctgtgg tggtgaggcg gcggtcaccc cgtcctagcc ccgtgccaaa acctagtcct
     1021 ccactttcca gcacatccca gatgggctca actctgccga gtggtgccgg gtatcagtct
     1081 gggacacacc aaggtcagtt cgaccatggt tctgggtccc tgagtccatc caaaaagagc
     1141 cctgtgggta agagtccacc atccactggc tccacatatg gctcatctca gaaggaggag
     1201 agtgctgctt caggaggagc agcctataca aagaggtatc tagaagagca gaagacagag
     1261 aatggaaaag ataaggaaca gaaacaaaca aataccgata aagaaaaaaa aaaaaaaaaa
     1321 a
//