LOCUS       BC001883                2464 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens nucleolar and coiled-body phosphoprotein 1, mRNA (cDNA
            clone MGC:1494 IMAGE:3533568), complete cds.
ACCESSION   BC001883
VERSION     BC001883.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2464)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 2464)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JAN-2001) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 8 Row: a Column: 11
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 4758859.
FEATURES             Location/Qualifiers
     source          1..2464
                     /db_xref="H-InvDB:HIT000030719"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:1494 IMAGE:3533568"
                     /tissue_type="Lung, small cell carcinoma"
                     /clone_lib="NIH_MGC_7"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..2464
                     /gene="NOLC1"
                     /gene_synonym="KIAA0035"
                     /gene_synonym="NOPP130"
                     /gene_synonym="NOPP140"
                     /gene_synonym="NS5ATP13"
                     /gene_synonym="P130"
                     /db_xref="GeneID:9221"
                     /db_xref="HGNC:HGNC:15608"
                     /db_xref="MIM:602394"
     CDS             8..2110
                     /gene="NOLC1"
                     /gene_synonym="KIAA0035"
                     /gene_synonym="NOPP130"
                     /gene_synonym="NOPP140"
                     /gene_synonym="NS5ATP13"
                     /gene_synonym="P130"
                     /codon_start=1
                     /product="nucleolar and coiled-body phosphoprotein 1"
                     /protein_id="AAH01883.1"
                     /db_xref="GeneID:9221"
                     /db_xref="HGNC:HGNC:15608"
                     /db_xref="MIM:602394"
                     /translation="MADAGIRRVVPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQD
                     ANASSLLDIYSFWLNRSAKVPERKLQANGPVAKKAKKKASSSDSEDSSEEEEEVQGPP
                     AKKAAVPAKRVGLPPGKAAAKASESSSSEESSDDDDEEDQKKQPVQKGVKPQAKAAKA
                     PPKKAKSSDSDSDSSSEDEPPKNQKPKITPVTVKAQTKAPPKPARAAPKIANGKAASS
                     SSSSSSSSSSDDSEEEKAAATPKKTVPKKQVVAKAPVKAATTPTRKSSSSEDSSSDEE
                     EEQKKPMKNKPGPYSSVPPPSAPPPKKSLGTQPPKKAVEKQQPVESSEDSSDESDSSS
                     EEEKKPPTKAVVSKATTKPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKP
                     AVTTKSPAVKPAAAPKQPVGGGQKLLTRKADSSSSEEESSSSEEEKTKKMVATTKPKA
                     TAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAVKKKPQKVAGGAAPSKPA
                     SAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAAKNSEE
                     EEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASS
                     PFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGS
                     YRGGSISVQVNSIKFDSE"
BASE COUNT          774 a          595 c          652 g          443 t
ORIGIN      
        1 ctggaggatg gcggacgccg gcattcgccg cgtggttccc agcgacctgt atcccctcgt
       61 gctcggcttc ctgcgcgata accaactctc agaggtggcc aataagttcg ccaaagcgac
      121 aggagctaca cagcaggatg ccaatgcctc ttccctctta gacatctata gcttctggct
      181 caacaggtct gccaaggtcc cagagcgaaa gttacaggca aatggaccag tggctaagaa
      241 agctaagaag aaggcctcat ccagtgacag tgaggacagc agcgaggagg aggaggaagt
      301 tcaagggcct ccagcaaaga aggctgctgt acctgccaag cgagtcggtc tgcctcctgg
      361 gaaggctgca gccaaagcat cagagagtag cagcagtgaa gagtccagtg atgatgatga
      421 tgaggaggac caaaagaaac agcctgtcca gaagggagtt aagccccaag ccaaggcagc
      481 caaagctcct cctaagaagg ccaagagctc tgattctgat tctgactcaa gctccgagga
      541 tgagccacca aagaaccaga agccaaagat aacacctgtg acagttaaag ctcagactaa
      601 agcccctccc aaaccagctc gagcagcacc taaaatagcc aatggtaaag cagccagtag
      661 cagcagtagc agcagcagca gcagtagcag tgatgactca gaggaggaga aggcagcagc
      721 cacccccaag aagactgtac ctaaaaagca agttgtggcc aaggccccag tgaaagcagc
      781 taccacccct acccggaaga gttctagcag tgaggattcc tccagtgacg aggaagagga
      841 gcaaaaaaaa cccatgaaaa ataaaccagg tccctacagt tcagtccccc cgccttctgc
      901 tcccccacca aagaagtctc tgggaaccca gcctcccaag aaggctgtgg agaagcagca
      961 gcctgtggaa agcagtgaag acagcagtga tgagtctgat tcaagttctg aagaagagaa
     1021 gaaaccccca actaaggcag tagtctctaa agcaaccact aaaccacctc cagcaaagaa
     1081 agcagcagag agctcttcag acagctcaga ctctgacagc tctgaggatg atgaagctcc
     1141 ttctaagcca gctggtacca ccaagaattc ttcaaataag ccagctgtca ccaccaagtc
     1201 acctgcagtg aagccagctg cagcccccaa gcaacctgtg ggcggtggcc agaagcttct
     1261 gacgagaaag gctgacagca gctccagtga ggaagagagc agctccagtg aggaggagaa
     1321 gacaaagaag atggtggcca ccactaagcc caaggcgact gccaaagcag ctctatctct
     1381 gcctgccaag caggctcctc agggtagtag ggacagcagc tctgattcag acagctccag
     1441 cagtgaggag gaggaagaga agacatctaa gtctgcagtt aagaagaagc cacagaaggt
     1501 agcaggaggt gcagcccctt ccaagccagc ctctgcaaag aaaggaaagg ctgagagcag
     1561 caacagttct tcttctgatg actccagtga ggaagaggaa gagaagctca agggcaaggg
     1621 ctctccaaga ccacaagccc ccaaggccaa tggcacctct gcactgactg cccagaatgg
     1681 aaaagcagct aagaacagtg aggaggagga agaagaaaag aaaaaggcgg cagtggtagt
     1741 ttccaaatca ggttcattaa agaagcggaa gcagaatgag gctgccaagg aggcagagac
     1801 tcctcaggcc aagaagataa agcttcagac ccctaacaca tttccaaaaa ggaagaaagg
     1861 agaaaaaagg gcatcatccc cattccgaag ggtcagggag gaggaaattg aggtggattc
     1921 acgagttgcg gacaactcct ttgatgccaa gcgaggtgca gccggagact ggggagagcg
     1981 agccaatcag gttttgaagt tcaccaaagg caagtccttt cggcatgaga aaaccaagaa
     2041 gaagcggggc agctaccggg gaggctcaat ctctgtccag gtcaattcta ttaagtttga
     2101 cagcgagtga cctgaggcca tcttcggtga agcaagggtg atgatcggag actacttact
     2161 ttctccagtg gacctgggaa ccctcaggtc tctaggtgag ggtcttgatg aggacagaag
     2221 tttagagtag gtcctaagac tttacagtgt aacatcctct ctggtccttt tctgtgttcc
     2281 tagttttgta cagacttgtt tttgagtgtt gagtagcagg gacaaaataa gggaatgtta
     2341 ttttttaaga aaattcattt tcattgttgt ctccttcctt ttctgtgaaa gtcctcatac
     2401 tgagaaattt gtatatttta tattaaatca cttactattg aaaaaaaaaa aaaaaaaaaa
     2461 aaaa
//