LOCUS       BC001390                 400 bp    mRNA    linear   HUM 19-JUN-2006
DEFINITION  Homo sapiens ubiquinol-cytochrome c reductase, complex III subunit
            VII, 9.5kDa, mRNA (cDNA clone MGC:785 IMAGE:3050489), complete cds.
ACCESSION   BC001390
VERSION     BC001390.2
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 400)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 400)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-DEC-2000) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     On Sep 16, 2003 this sequence version replaced gi:12655078.
            Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC/DCTD/DTP
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: National Institutes of Health Intramural
            Sequencing Center (NISC),
            Gaithersburg, Maryland;
            Web site: http://www.nisc.nih.gov/
            Contact: nisc_mgc@nhgri.nih.gov
            Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
            Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
            Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
            Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
            Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
            McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
            Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
            Young,A., Zhang,L.-H. and Green,E.D.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 4 Row: m Column: 3
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 27894387.
FEATURES             Location/Qualifiers
     source          1..400
                     /db_xref="H-InvDB:HIT000030373"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:785 IMAGE:3050489"
                     /tissue_type="Skin, melanotic melanoma."
                     /clone_lib="NIH_MGC_20"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..400
                     /gene="UQCRQ"
                     /gene_synonym="QP-C"
                     /db_xref="GeneID:27089"
                     /db_xref="HGNC:HGNC:29594"
     CDS             28..276
                     /gene="UQCRQ"
                     /gene_synonym="QP-C"
                     /codon_start=1
                     /product="ubiquinol-cytochrome c reductase, complex III
                     subunit VII, 9.5kDa"
                     /protein_id="AAH01390.1"
                     /db_xref="GI:12655079"
                     /db_xref="GeneID:27089"
                     /db_xref="HGNC:HGNC:29594"
                     /translation="MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRE
                     SFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK"
BASE COUNT          108 a           97 c          102 g           93 t
ORIGIN      
        1 gcgagctgag ccctggccgc cgccacaatg ggccgcgagt ttgggaatct gacgcggatg
       61 cggcatgtga tcagctacag cttgtcaccg ttcgagcagc gcgcctatcc gcacgtcttc
      121 actaaaggaa tccccaatgt tctgcgccgc attcgggagt ctttctttcg cgtggtgccg
      181 cagtttgtag tgttttatct tatctacaca tgggggactg aagagttcga gagatccaag
      241 aggaagaatc cagctgccta tgaaaatgac aaatgagcaa cgcatccgga tgacggttcc
      301 ctgtctctga aagacctttc tctggaagag gagtctgcat tgtagtgtct caaagacaca
      361 ataaacttcc tatggtctgc aaaaaaaaaa aaaaaaaaaa
//