LOCUS       BC001219                1223 bp    mRNA    linear   HUM 15-JUL-2006
DEFINITION  Homo sapiens zinc finger protein 581, mRNA (cDNA clone MGC:860
            IMAGE:3528677), complete cds.
ACCESSION   BC001219
VERSION     BC001219.1
KEYWORDS    MGC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1223)
  AUTHORS   Strausberg,R.L., Feingold,E.A., Grouse,L.H., Derge,J.G.,
            Klausner,R.D., Collins,F.S., Wagner,L., Shenmen,C.M., Schuler,G.D.,
            Altschul,S.F., Zeeberg,B., Buetow,K.H., Schaefer,C.F., Bhat,N.K.,
            Hopkins,R.F., Jordan,H., Moore,T., Max,S.I., Wang,J., Hsieh,F.,
            Diatchenko,L., Marusina,K., Farmer,A.A., Rubin,G.M., Hong,L.,
            Stapleton,M., Soares,M.B., Bonaldo,M.F., Casavant,T.L.,
            Scheetz,T.E., Brownstein,M.J., Usdin,T.B., Toshiyuki,S.,
            Carninci,P., Prange,C., Raha,S.S., Loquellano,N.A., Peters,G.J.,
            Abramson,R.D., Mullahy,S.J., Bosak,S.A., McEwan,P.J.,
            McKernan,K.J., Malek,J.A., Gunaratne,P.H., Richards,S.,
            Worley,K.C., Hale,S., Garcia,A.M., Gay,L.J., Hulyk,S.W.,
            Villalon,D.K., Muzny,D.M., Sodergren,E.J., Lu,X., Gibbs,R.A.,
            Fahey,J., Helton,E., Ketteman,M., Madan,A., Rodrigues,S.,
            Sanchez,A., Whiting,M., Madan,A., Young,A.C., Shevchenko,Y.,
            Bouffard,G.G., Blakesley,R.W., Touchman,J.W., Green,E.D.,
            Dickson,M.C., Rodriguez,A.C., Grimwood,J., Schmutz,J., Myers,R.M.,
            Butterfield,Y.S., Krzywinski,M.I., Skalska,U., Smailus,D.E.,
            Schnerch,A., Schein,J.E., Jones,S.J. and Marra,M.A.
  CONSRTM   Mammalian Gene Collection Program Team
  TITLE     Generation and initial analysis of more than 15,000 full-length
            human and mouse cDNA sequences
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002)
   PUBMED   12477932
REFERENCE   2  (bases 1 to 1223)
  CONSRTM   NIH MGC Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2000) National Institutes of Health, Mammalian
            Gene Collection (MGC), Bethesda, MD 20892-2590, USA
  REMARK    NIH-MGC Project URL: http://mgc.nci.nih.gov
COMMENT     Contact: MGC help desk
            Email: cgapbs-r@mail.nih.gov
            Tissue Procurement: ATCC
            cDNA Library Preparation: Rubin Laboratory
            cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
            DNA Sequencing by: Genome Sequence Centre,
            BC Cancer Agency, Vancouver, BC, Canada
            info@bcgsc.bc.ca
            Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
            Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
            Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
            Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
            Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
            Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
            Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
            Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
            Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
            
            Clone distribution: MGC clone distribution information can be found
            through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
            Series: IRAL Plate: 8 Row: o Column: 7
            This clone was selected for full length sequencing because it
            passed the following selection criteria: matched mRNA gi: 50592985.
FEATURES             Location/Qualifiers
     source          1..1223
                     /db_xref="H-InvDB:HIT000030230"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /clone="MGC:860 IMAGE:3528677"
                     /tissue_type="Muscle, rhabdomyosarcoma"
                     /clone_lib="NIH_MGC_17"
                     /lab_host="DH10B-R"
                     /note="Vector: pOTB7"
     gene            1..1223
                     /gene="ZNF581"
                     /gene_synonym="FLJ22550"
                     /gene_synonym="HSPC189"
                     /db_xref="GeneID:51545"
                     /db_xref="HGNC:HGNC:25017"
     CDS             144..737
                     /gene="ZNF581"
                     /gene_synonym="FLJ22550"
                     /gene_synonym="HSPC189"
                     /codon_start=1
                     /product="zinc finger protein 581"
                     /protein_id="AAH01219.1"
                     /db_xref="GeneID:51545"
                     /db_xref="HGNC:HGNC:25017"
                     /translation="MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQA
                     SSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCPVCSRVFEYMSYL
                     QRHSITHSEVKPFECDICGKAFKRASHLARHHSIHLAGGGRPHGCPLCPRRFRDAGEL
                     AQHSRVHSGERPFQCPHCPRRFMEQNTLQKHTRWKHP"
BASE COUNT          251 a          389 c          351 g          232 t
ORIGIN      
        1 ctttcggccg gcgccgccag ttcctggggc acacccagag gtccccttct cgccgccgcc
       61 tgcaactgcg agggtagccc ggggccgctt ggagtcgccc ggacctgaga ggctgctgca
      121 ctgggcctca gccagccctc cggatgctgg tgctgccatc cccctgccct cagcctctgg
      181 cattttcctc cgttgagacc atggagggcc ctccccgtcg gacttgccgc tccccagaac
      241 ctggaccttc ctcctccatc ggatctcccc aggcttcatc tcctccaagg cccaaccact
      301 acctgcttat tgacactcag ggtgtcccct acacagtgct ggtggacgag gagtcacaga
      361 gggagccagg ggccagtggg gctccaggcc agaaaaagtg ctacagctgc cccgtgtgct
      421 caagggtctt cgagtacatg tcctaccttc agcgacacag catcacccac tcggaggtaa
      481 agcccttcga gtgtgacatc tgtgggaagg cattcaagcg cgccagccac ttggcacggc
      541 accattccat tcacctggcg ggtggtgggc ggccccacgg ctgcccgctc tgccctcgcc
      601 gcttccggga tgcgggtgag ctggcccagc acagccgggt gcactctggg gagcgcccgt
      661 ttcagtgtcc acactgccct cgccgcttta tggagcagaa cacactgcag aaacacacgc
      721 ggtggaagca tccatgagcc gggctgccgg gtgccccagg taccacagga ctttgcaggg
      781 agcctggact cctgtccaga cacctggtga gagcctgagg ctggtgttca gggccctgga
      841 cacagacaca gagcagccgc atctcaaagg cagagccctg cctgaaggag gaatccgtga
      901 gtaatcttca ggtcctccgt gttctggagc tgagatggga atgagcccct acacagaatg
      961 gagtcctcta gcctaaagat atcagctgtt ccatggcaga gccttgactg gatggaggtg
     1021 gggagtgtgg tgtgtaaagt ctctggcctc ataaaaggtg gctgtgggtc gtcaggaatc
     1081 tgcgccatct tcctggggct tctgcgctgt tgttggggaa gggaccccag tcctgccttc
     1141 caccccccaa ccaggcctga gactgatcaa acaataaaca cgtttcccac tctgaaaaaa
     1201 aaaaaaaaaa aaaaaaaaaa aaa
//